PI0008167.1 (mRNA) Melon (PI 482460) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGGAACAAACCCTCTGGGACCAAGCAAGCATTTTTCGTCCTCGGAGCCTTGGCGATGGGTTGGCTCGCCATTGAGATGGCTTTCAAACCCTTCCTCGATCAGGCCCGCTCCGCCATGGACAAATCTGATCCCGCTCGGGATCCTGACGAACTTGTCGATAACCAATCCGATCACACCTCATCTGATGAAGATCGAAGTACCACTGGCACTGCTTAAATGAGGAACAAACCCTCTGGGACCAAGCAAGCATTTTTCGTCCTCGGAGCCTTGGCGATGGGTTGGCTCGCCATTGAGATGGCTTTCAAACCCTTCCTCGATCAGGCCCGCTCCGCCATGGACAAATCTGATCCCGCTCGGGATCCTGACGAACTTGTCGATAACCAATCCGATCACACCTCATCTGATGAAGATCGAAGTACCACTGGCACTGCTTAA ATGAGGAACAAACCCTCTGGGACCAAGCAAGCATTTTTCGTCCTCGGAGCCTTGGCGATGGGTTGGCTCGCCATTGAGATGGCTTTCAAACCCTTCCTCGATCAGGCCCGCTCCGCCATGGACAAATCTGATCCCGCTCGGGATCCTGACGAACTTGTCGATAACCAATCCGATCACACCTCATCTGATGAAGATCGAAGTACCACTGGCACTGCTTAA MRNKPSGTKQAFFVLGALAMGWLAIEMAFKPFLDQARSAMDKSDPARDPDELVDNQSDHTSSDEDRSTTGTA Homology
BLAST of PI0008167.1 vs. ExPASy Swiss-Prot
Match: Q9SVC4 (Outer envelope membrane protein 7 OS=Arabidopsis thaliana OX=3702 GN=OEP7 PE=1 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 2.6e-11 Identity = 36/61 (59.02%), Postives = 47/61 (77.05%), Query Frame = 0
BLAST of PI0008167.1 vs. ExPASy TrEMBL
Match: A0A5A7URM9 (6.7 kDa chloroplast outer envelope membrane protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold496G00570 PE=4 SV=1) HSP 1 Score: 118.2 bits (295), Expect = 1.4e-23 Identity = 60/72 (83.33%), Postives = 65/72 (90.28%), Query Frame = 0
BLAST of PI0008167.1 vs. ExPASy TrEMBL
Match: A0A6J1HGS4 (outer envelope membrane protein 7-like OS=Cucurbita moschata OX=3662 GN=LOC111463949 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 2.2e-21 Identity = 54/69 (78.26%), Postives = 61/69 (88.41%), Query Frame = 0
BLAST of PI0008167.1 vs. ExPASy TrEMBL
Match: A0A6J1DS29 (outer envelope membrane protein 7-like OS=Momordica charantia OX=3673 GN=LOC111022685 PE=4 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 3.8e-21 Identity = 55/69 (79.71%), Postives = 60/69 (86.96%), Query Frame = 0
BLAST of PI0008167.1 vs. ExPASy TrEMBL
Match: A0A6J1HUQ5 (outer envelope membrane protein 7-like OS=Cucurbita maxima OX=3661 GN=LOC111467002 PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 4.9e-21 Identity = 53/68 (77.94%), Postives = 61/68 (89.71%), Query Frame = 0
BLAST of PI0008167.1 vs. ExPASy TrEMBL
Match: A0A0A0KJE9 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G409970 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 3.2e-20 Identity = 57/72 (79.17%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of PI0008167.1 vs. NCBI nr
Match: KAA0057297.1 (6.7 kDa chloroplast outer envelope membrane protein [Cucumis melo var. makuwa] >TYK13436.1 6.7 kDa chloroplast outer envelope membrane protein [Cucumis melo var. makuwa]) HSP 1 Score: 118.2 bits (295), Expect = 2.8e-23 Identity = 60/72 (83.33%), Postives = 65/72 (90.28%), Query Frame = 0
BLAST of PI0008167.1 vs. NCBI nr
Match: XP_038888886.1 (outer envelope membrane protein 7-like [Benincasa hispida] >XP_038888887.1 outer envelope membrane protein 7-like [Benincasa hispida] >XP_038888888.1 outer envelope membrane protein 7-like [Benincasa hispida] >XP_038888889.1 outer envelope membrane protein 7-like [Benincasa hispida]) HSP 1 Score: 115.9 bits (289), Expect = 1.4e-22 Identity = 58/72 (80.56%), Postives = 65/72 (90.28%), Query Frame = 0
BLAST of PI0008167.1 vs. NCBI nr
Match: XP_023553591.1 (outer envelope membrane protein 7-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 113.2 bits (282), Expect = 9.2e-22 Identity = 55/69 (79.71%), Postives = 62/69 (89.86%), Query Frame = 0
BLAST of PI0008167.1 vs. NCBI nr
Match: XP_022963695.1 (outer envelope membrane protein 7-like [Cucurbita moschata] >XP_022963696.1 outer envelope membrane protein 7-like [Cucurbita moschata] >XP_022963697.1 outer envelope membrane protein 7-like [Cucurbita moschata] >KAG7011240.1 Outer envelope membrane protein 7, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 110.9 bits (276), Expect = 4.5e-21 Identity = 54/69 (78.26%), Postives = 61/69 (88.41%), Query Frame = 0
BLAST of PI0008167.1 vs. NCBI nr
Match: XP_022155586.1 (outer envelope membrane protein 7-like [Momordica charantia]) HSP 1 Score: 110.2 bits (274), Expect = 7.8e-21 Identity = 55/69 (79.71%), Postives = 60/69 (86.96%), Query Frame = 0
BLAST of PI0008167.1 vs. TAIR 10
Match: AT3G52420.1 (outer envelope membrane protein 7 ) HSP 1 Score: 68.9 bits (167), Expect = 1.8e-12 Identity = 36/61 (59.02%), Postives = 47/61 (77.05%), Query Frame = 0
BLAST of PI0008167.1 vs. TAIR 10
Match: AT3G63160.1 (FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast outer membrane, thylakoid, chloroplast thylakoid membrane, chloroplast, chloroplast envelope; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: outer envelope membrane protein 7 (TAIR:AT3G52420.1); Has 26 Blast hits to 26 proteins in 8 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 26; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 48.1 bits (113), Expect = 3.4e-06 Identity = 24/42 (57.14%), Postives = 30/42 (71.43%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (PI 482460) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|