
MS028584.1 (mRNA) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTTGTTATCCTTCACAAAATGGGGATGTACAACTGGGCATCCTTTTTCGAGGTACTGAATCCGAAGCCTATTATCTTCGTATTCACGAAGAAGTGCCCAGTGAAATCCTGGCATCAGCATCAGTAGACATGGCCACTACCAAGAATCTTAAGCGACTCGTAAAATTCGGTGAACAATTGTTGGACAAGCCTGTCTCCAAGGAGGGGATGCTTTATATAGAGGATGCAGTGCACAAGGGTTACCCCTCTGAAACCAATCGCCAAGCTTTGGTCAGGTTCGCCAAATTGCTCTCACACAACAAAAGGTCTTCTTCTACCAACAACACCAGAACTTGA ATGTTTTGTTATCCTTCACAAAATGGGGATGTACAACTGGGCATCCTTTTTCGAGGTACTGAATCCGAAGCCTATTATCTTCGTATTCACGAAGAAGTGCCCAGTGAAATCCTGGCATCAGCATCAGTAGACATGGCCACTACCAAGAATCTTAAGCGACTCGTAAAATTCGGTGAACAATTGTTGGACAAGCCTGTCTCCAAGGAGGGGATGCTTTATATAGAGGATGCAGTGCACAAGGGTTACCCCTCTGAAACCAATCGCCAAGCTTTGGTCAGGTTCGCCAAATTGCTCTCACACAACAAAAGGTCTTCTTCTACCAACAACACCAGAACTTGA ATGTTTTGTTATCCTTCACAAAATGGGGATGTACAACTGGGCATCCTTTTTCGAGGTACTGAATCCGAAGCCTATTATCTTCGTATTCACGAAGAAGTGCCCAGTGAAATCCTGGCATCAGCATCAGTAGACATGGCCACTACCAAGAATCTTAAGCGACTCGTAAAATTCGGTGAACAATTGTTGGACAAGCCTGTCTCCAAGGAGGGGATGCTTTATATAGAGGATGCAGTGCACAAGGGTTACCCCTCTGAAACCAATCGCCAAGCTTTGGTCAGGTTCGCCAAATTGCTCTCACACAACAAAAGGTCTTCTTCTACCAACAACACCAGAACTTGA MFCYPSQNGDVQLGILFRGTESEAYYLRIHEEVPSEILASASVDMATTKNLKRLVKFGEQLLDKPVSKEGMLYIEDAVHKGYPSETNRQALVRFAKLLSHNKRSSSTNNTRT Homology
BLAST of MS028584.1 vs. NCBI nr
Match: XP_022159387.1 (patatin-like protein 2 [Momordica charantia]) HSP 1 Score: 211.8 bits (538), Expect = 2.9e-51 Identity = 105/112 (93.75%), Postives = 109/112 (97.32%), Query Frame = 0
BLAST of MS028584.1 vs. NCBI nr
Match: KAB1220376.1 (Patatin-like protein 2 [Morella rubra]) HSP 1 Score: 78.2 bits (191), Expect = 5.1e-11 Identity = 45/94 (47.87%), Postives = 63/94 (67.02%), Query Frame = 0
BLAST of MS028584.1 vs. NCBI nr
Match: XP_040997731.1 (patatin-like protein 2 [Juglans microcarpa x Juglans regia]) HSP 1 Score: 76.6 bits (187), Expect = 1.5e-10 Identity = 49/100 (49.00%), Postives = 65/100 (65.00%), Query Frame = 0
BLAST of MS028584.1 vs. NCBI nr
Match: KAG8632591.1 (hypothetical protein MANES_18G033422v8 [Manihot esculenta]) HSP 1 Score: 76.6 bits (187), Expect = 1.5e-10 Identity = 43/94 (45.74%), Postives = 61/94 (64.89%), Query Frame = 0
BLAST of MS028584.1 vs. NCBI nr
Match: KAG5251292.1 (patatin family protein [Salix suchowensis]) HSP 1 Score: 76.3 bits (186), Expect = 1.9e-10 Identity = 45/94 (47.87%), Postives = 61/94 (64.89%), Query Frame = 0
BLAST of MS028584.1 vs. ExPASy Swiss-Prot
Match: O48723 (Patatin-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=PLP2 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 7.1e-08 Identity = 34/94 (36.17%), Postives = 55/94 (58.51%), Query Frame = 0
BLAST of MS028584.1 vs. ExPASy Swiss-Prot
Match: A2YW91 (Patatin-like protein 2 OS=Oryza sativa subsp. indica OX=39946 GN=PLP2 PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 3.5e-07 Identity = 38/97 (39.18%), Postives = 54/97 (55.67%), Query Frame = 0
BLAST of MS028584.1 vs. ExPASy Swiss-Prot
Match: Q6ZJD3 (Patatin-like protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=PLP2 PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 3.5e-07 Identity = 38/97 (39.18%), Postives = 54/97 (55.67%), Query Frame = 0
BLAST of MS028584.1 vs. ExPASy Swiss-Prot
Match: O23181 (Patatin-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=PLP3 PE=2 SV=2) HSP 1 Score: 54.7 bits (130), Expect = 7.9e-07 Identity = 38/96 (39.58%), Postives = 56/96 (58.33%), Query Frame = 0
BLAST of MS028584.1 vs. ExPASy Swiss-Prot
Match: Q2MY43 (Patatin-08 OS=Solanum tuberosum OX=4113 PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 6.7e-06 Identity = 34/94 (36.17%), Postives = 48/94 (51.06%), Query Frame = 0
BLAST of MS028584.1 vs. ExPASy TrEMBL
Match: A0A6J1DZQ3 (patatin-like protein 2 OS=Momordica charantia OX=3673 GN=LOC111025803 PE=4 SV=1) HSP 1 Score: 211.8 bits (538), Expect = 1.4e-51 Identity = 105/112 (93.75%), Postives = 109/112 (97.32%), Query Frame = 0
BLAST of MS028584.1 vs. ExPASy TrEMBL
Match: A0A6A1W7T7 (Patatin OS=Morella rubra OX=262757 GN=CJ030_MR3G009836 PE=3 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 2.5e-11 Identity = 45/94 (47.87%), Postives = 63/94 (67.02%), Query Frame = 0
BLAST of MS028584.1 vs. ExPASy TrEMBL
Match: A0A2I4E9L9 (Patatin OS=Juglans regia OX=51240 GN=LOC108987613 PE=3 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 1.6e-10 Identity = 47/112 (41.96%), Postives = 69/112 (61.61%), Query Frame = 0
BLAST of MS028584.1 vs. ExPASy TrEMBL
Match: B9R7G7 (Patatin OS=Ricinus communis OX=3988 GN=RCOM_1591480 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 2.1e-10 Identity = 45/100 (45.00%), Postives = 63/100 (63.00%), Query Frame = 0
BLAST of MS028584.1 vs. ExPASy TrEMBL
Match: B9R7G6 (Patatin OS=Ricinus communis OX=3988 GN=RCOM_1591470 PE=3 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 2.7e-10 Identity = 43/94 (45.74%), Postives = 59/94 (62.77%), Query Frame = 0
BLAST of MS028584.1 vs. TAIR 10
Match: AT2G26560.1 (phospholipase A 2A ) HSP 1 Score: 58.2 bits (139), Expect = 5.1e-09 Identity = 34/94 (36.17%), Postives = 55/94 (58.51%), Query Frame = 0
BLAST of MS028584.1 vs. TAIR 10
Match: AT4G37050.1 (PATATIN-like protein 4 ) HSP 1 Score: 54.7 bits (130), Expect = 5.6e-08 Identity = 38/96 (39.58%), Postives = 56/96 (58.33%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|