MS013426.1 (mRNA) Bitter gourd (TR) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GTCAGGAGCATGAAATCAAGAATTTTGGCTACTTACCCTGATGCATTTCCAGATGAGTCAACGAGTGAAGCTCTTGACAGGAGACCAGACCTTGAAATGCCTCAGGTCAGGAGCATGAAATCAAGAATTTTGGCTACTTACCCTGATGCATTTCCAGATGAGTCAACGAGTGAAGCTCTTGACAGGAGACCAGACCTTGAAATGCCTCAG GTCAGGAGCATGAAATCAAGAATTTTGGCTACTTACCCTGATGCATTTCCAGATGAGTCAACGAGTGAAGCTCTTGACAGGAGACCAGACCTTGAAATGCCTCAG VRSMKSRILATYPDAFPDESTSEALDRRPDLEMPQ Homology
BLAST of MS013426.1 vs. NCBI nr
Match: XP_023541035.1 (kxDL motif-containing protein 1 isoform X2 [Cucurbita pepo subsp. pepo] >XP_023541036.1 kxDL motif-containing protein 1 isoform X2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 70.1 bits (170), Expect = 4.3e-09 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 0
BLAST of MS013426.1 vs. NCBI nr
Match: XP_022994923.1 (kxDL motif-containing protein 1 [Cucurbita maxima]) HSP 1 Score: 70.1 bits (170), Expect = 4.3e-09 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 0
BLAST of MS013426.1 vs. NCBI nr
Match: XP_022954848.1 (kxDL motif-containing protein 1 [Cucurbita moschata] >KAG6573400.1 KxDL motif-containing protein 1, partial [Cucurbita argyrosperma subsp. sororia] >KAG7012563.1 KxDL motif-containing protein 1 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 70.1 bits (170), Expect = 4.3e-09 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 0
BLAST of MS013426.1 vs. NCBI nr
Match: XP_008460924.1 (PREDICTED: kxDL motif-containing protein 1 [Cucumis melo] >XP_008460925.1 PREDICTED: kxDL motif-containing protein 1 [Cucumis melo] >KAA0045516.1 kxDL motif-containing protein 1 [Cucumis melo var. makuwa] >TYK02105.1 kxDL motif-containing protein 1 [Cucumis melo var. makuwa]) HSP 1 Score: 69.3 bits (168), Expect = 7.4e-09 Identity = 32/35 (91.43%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of MS013426.1 vs. NCBI nr
Match: XP_004150678.1 (kxDL motif-containing protein 1 [Cucumis sativus]) HSP 1 Score: 68.2 bits (165), Expect = 1.6e-08 Identity = 31/35 (88.57%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of MS013426.1 vs. ExPASy TrEMBL
Match: A0A6J1K6F6 (kxDL motif-containing protein 1 OS=Cucurbita maxima OX=3661 GN=LOC111490503 PE=3 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 2.1e-09 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 0
BLAST of MS013426.1 vs. ExPASy TrEMBL
Match: A0A6J1GS89 (kxDL motif-containing protein 1 OS=Cucurbita moschata OX=3662 GN=LOC111456987 PE=3 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 2.1e-09 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 0
BLAST of MS013426.1 vs. ExPASy TrEMBL
Match: A0A1S3CER9 (kxDL motif-containing protein 1 OS=Cucumis melo OX=3656 GN=LOC103499662 PE=3 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 3.6e-09 Identity = 32/35 (91.43%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of MS013426.1 vs. ExPASy TrEMBL
Match: A0A5A7TTR7 (KxDL motif-containing protein 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold680G00930 PE=3 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 3.6e-09 Identity = 32/35 (91.43%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of MS013426.1 vs. ExPASy TrEMBL
Match: A0A0A0LK01 (KxDL domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_2G299930 PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 8.0e-09 Identity = 31/35 (88.57%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of MS013426.1 vs. TAIR 10
Match: AT3G29130.1 (CONTAINS InterPro DOMAIN/s: Domain of unknown function KxDL (InterPro:IPR019371); Has 135 Blast hits to 135 proteins in 54 species: Archae - 0; Bacteria - 0; Metazoa - 106; Fungi - 0; Plants - 26; Viruses - 0; Other Eukaryotes - 3 (source: NCBI BLink). ) HSP 1 Score: 63.9 bits (154), Expect = 2.9e-11 Identity = 28/35 (80.00%), Postives = 34/35 (97.14%), Query Frame = 0
BLAST of MS013426.1 vs. TAIR 10
Match: AT3G29130.2 (FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; CONTAINS InterPro DOMAIN/s: Domain of unknown function KxDL (InterPro:IPR019371). ) HSP 1 Score: 63.9 bits (154), Expect = 2.9e-11 Identity = 28/35 (80.00%), Postives = 34/35 (97.14%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|