
MS013421.1 (mRNA) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.GAAAAACACTTCGAATTGTTGATTCGTCGCCAAAGATGGCTTAAACCAATAGTTCATTATCTAATGGATTTTTCTGTTCTATACTCCATCCGAAAGTTATCAGTATTTATCAAATTTGTTACCATCTAACGGAACGCTATTGGATCAAATGACAAAGACATTGTTGAGAAAAAAAGTGTTTTACCCGAATGAAATGAAAATTAGATTCATG GAAAAACACTTCGAATTGTTGATTCGTCGCCAAAGATGGCTTACCAATAGTTCATTATCTAATGGATTTTTCTGTTCTACTCCATCCGAAAGTTATCAGTATTTATCAAATTTGTTACCATCTAACGGAACGCTATTGGATCAAATGACAAAGACATTGTTGAGAAAAAAAGTGTTTTACCCGAATGAAATGAAAATTAGATTCATG GAAAAACACTTCGAATTGTTGATTCGTCGCCAAAGATGGCTTACCAATAGTTCATTATCTAATGGATTTTTCTGTTCTACTCCATCCGAAAGTTATCAGTATTTATCAAATTTGTTACCATCTAACGGAACGCTATTGGATCAAATGACAAAGACATTGTTGAGAAAAAAAGTGTTTTACCCGAATGAAATGAAAATTAGATTCATG EKHFELLIRRQRWLTNSSLSNGFFCSTPSESYQYLSNLLPSNGTLLDQMTKTLLRKKVFYPNEMKIRFM Homology
BLAST of MS013421.1 vs. NCBI nr
Match: YP_010143466.1 (Ycf2 [Peganum harmala] >YP_010143486.1 Ycf2 [Peganum harmala] >QQL04673.1 Ycf2 [Peganum harmala] >QQL04693.1 Ycf2 [Peganum harmala]) HSP 1 Score: 108.6 bits (270), Expect = 2.2e-20 Identity = 59/71 (83.10%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS013421.1 vs. NCBI nr
Match: YP_009873430.1 (hypothetical protein RF2 [Acer sutchuenense subsp. tienchuanense] >YP_009873452.1 hypothetical protein RF2 [Acer sutchuenense subsp. tienchuanense] >QKT28465.1 hypothetical protein RF2 [Acer sutchuenense subsp. tienchuanense] >QKT28466.1 hypothetical protein RF2 [Acer sutchuenense subsp. tienchuanense]) HSP 1 Score: 108.6 bits (270), Expect = 2.2e-20 Identity = 59/71 (83.10%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS013421.1 vs. NCBI nr
Match: YP_009476227.1 (Ycf2 [Eurycorymbus cavaleriei] >YP_009476249.1 Ycf2 [Eurycorymbus cavaleriei] >AVM38231.1 Ycf2 [Eurycorymbus cavaleriei] >AVM38253.1 Ycf2 [Eurycorymbus cavaleriei]) HSP 1 Score: 108.6 bits (270), Expect = 2.2e-20 Identity = 59/71 (83.10%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS013421.1 vs. NCBI nr
Match: YP_009478404.1 (Ycf2 [Zanthoxylum simulans] >YP_009478424.1 Ycf2 [Zanthoxylum simulans] >YP_009917121.1 hypothetical protein RF2 [Zanthoxylum armatum] >YP_009917140.1 hypothetical protein RF2 [Zanthoxylum armatum] >AXZ62502.1 Ycf2 [Zanthoxylum sp. NH-2018] >AXZ62589.1 Ycf2 [Zanthoxylum schinifolium] >AVP50048.1 Ycf2 [Zanthoxylum simulans] >AVP50049.1 Ycf2 [Zanthoxylum simulans] >AXZ62503.1 Ycf2 [Zanthoxylum sp. NH-2018]) HSP 1 Score: 108.6 bits (270), Expect = 2.2e-20 Identity = 59/71 (83.10%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS013421.1 vs. NCBI nr
Match: YP_009412701.1 (Ycf2 [Phellodendron amurense] >YP_009412720.1 Ycf2 [Phellodendron amurense] >YP_009940610.1 Ycf2 [Phellodendron chinense] >YP_009940629.1 Ycf2 [Phellodendron chinense] >ASK50987.1 Ycf2 [Phellodendron amurense] >ASK50988.1 Ycf2 [Phellodendron amurense] >QNZ92250.1 Ycf2 [Phellodendron chinense] >QNZ92269.1 Ycf2 [Phellodendron chinense] >QYJ09033.1 hypothetical protein RF2 [Phellodendron chinense]) HSP 1 Score: 108.6 bits (270), Expect = 2.2e-20 Identity = 59/71 (83.10%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS013421.1 vs. ExPASy Swiss-Prot
Match: B1A978 (Protein Ycf2 OS=Carica papaya OX=3649 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 2.8e-23 Identity = 59/71 (83.10%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS013421.1 vs. ExPASy Swiss-Prot
Match: Q09MB4 (Protein Ycf2 OS=Citrus sinensis OX=2711 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 2.8e-23 Identity = 59/71 (83.10%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS013421.1 vs. ExPASy Swiss-Prot
Match: Q49KT6 (Protein Ycf2 OS=Eucalyptus globulus subsp. globulus OX=71271 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 1.4e-22 Identity = 58/71 (81.69%), Postives = 61/71 (85.92%), Query Frame = 0
BLAST of MS013421.1 vs. ExPASy Swiss-Prot
Match: A4QKE8 (Protein Ycf2 OS=Barbarea verna OX=50458 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.6e-21 Identity = 56/71 (78.87%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS013421.1 vs. ExPASy Swiss-Prot
Match: A4QLE9 (Protein Ycf2 OS=Lepidium virginicum OX=59292 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.6e-21 Identity = 56/71 (78.87%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS013421.1 vs. ExPASy TrEMBL
Match: A0A7G7XSR2 (Protein Ycf2 OS=Acer coriaceifolium OX=1779278 GN=ycf2 PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 1.0e-20 Identity = 59/71 (83.10%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS013421.1 vs. ExPASy TrEMBL
Match: A0A7L9CVW6 (Protein Ycf2 OS=Citrus hongheensis OX=496653 GN=ycf2 PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 1.0e-20 Identity = 59/71 (83.10%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS013421.1 vs. ExPASy TrEMBL
Match: A0A1B0V9X6 (Protein Ycf2 OS=Zanthoxylum schinifolium OX=354530 GN=ycf2 PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 1.0e-20 Identity = 59/71 (83.10%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS013421.1 vs. ExPASy TrEMBL
Match: A0A1Z1G971 (Protein Ycf2 OS=Anacardium occidentale OX=171929 GN=ycf2 PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 1.0e-20 Identity = 59/71 (83.10%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS013421.1 vs. ExPASy TrEMBL
Match: A0A159BNP4 (Protein Ycf2 OS=Citrus platymamma OX=237571 GN=ycf2 PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 1.0e-20 Identity = 59/71 (83.10%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS013421.1 vs. TAIR 10
Match: ATCG00860.1 (Chloroplast Ycf2;ATPase, AAA type, core ) HSP 1 Score: 99.8 bits (247), Expect = 9.4e-22 Identity = 55/71 (77.46%), Postives = 61/71 (85.92%), Query Frame = 0
BLAST of MS013421.1 vs. TAIR 10
Match: ATCG01280.1 (Chloroplast Ycf2;ATPase, AAA type, core ) HSP 1 Score: 99.8 bits (247), Expect = 9.4e-22 Identity = 55/71 (77.46%), Postives = 61/71 (85.92%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|