MELO3C034929.1 (mRNA) Melon (DHL92) v4
|
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGACCAAACGGTTGTGAAAATGGACGAGATTTTGAAATCCGTATTGATCGACGACGATGGCCACTGGAGAATCCAAATTCGTTGTTGAGTTAATTAATCGACGGCGAAGGGAACTGGAGAATCCAGCTTCTGACGACGATGTGACACCATTTTCGTACCTGGACACGCTTTTGATTTTAAAATCGATGGGCATGGTGGCGGAGGGAATTCGTCGACGACGGATAGGGAATTGGTGAATGGAAGACCAAACGGTTGTGAAAATGGACGAGATTTTGAAATCCGTATTGATCGACGACGATGGCCACTGGAGAATCCAAATTCGTTGTTGAGTTAATTAATCGACGGCGAAGGGAACTGGAGAATCCAGCTTCTGACGACGATGTGACACCATTTTCGTACCTGGACACGCTTTTGATTTTAAAATCGATGGGCATGGTGGCGGAGGGAATTCGTCGACGACGGATAGGGAATTGGTGA ATGGCCACTGGAGAATCCAAATTCGTTGTTGAGTTAATTAATCGACGGCGAAGGGAACTGGAGAATCCAGCTTCTGACGACGATGTGACACCATTTTCGTACCTGGACACGCTTTTGATTTTAAAATCGATGGGCATGGTGGCGGAGGGAATTCGTCGACGACGGATAGGGAATTGGTGA MATGESKFVVELINRRRRELENPASDDDVTPFSYLDTLLILKSMGMVAEGIRRRRIGNW Homology
BLAST of MELO3C034929.1 vs. ExPASy Swiss-Prot
Match: O48928 (Cytochrome P450 77A3 OS=Glycine max OX=3847 GN=CYP77A3 PE=2 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 1.1e-04 Identity = 21/39 (53.85%), Postives = 27/39 (69.23%), Query Frame = 0
BLAST of MELO3C034929.1 vs. ExPASy Swiss-Prot
Match: Q9LZ31 (Cytochrome P450 77A4 OS=Arabidopsis thaliana OX=3702 GN=CYP77A4 PE=2 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 2.5e-04 Identity = 21/38 (55.26%), Postives = 26/38 (68.42%), Query Frame = 0
BLAST of MELO3C034929.1 vs. NCBI nr
Match: KAA0059643.1 (cytochrome P450 77A3-like [Cucumis melo var. makuwa] >TYK08174.1 cytochrome P450 77A3-like [Cucumis melo var. makuwa]) HSP 1 Score: 87.8 bits (216), Expect = 3.4e-14 Identity = 43/53 (81.13%), Postives = 44/53 (83.02%), Query Frame = 0
BLAST of MELO3C034929.1 vs. NCBI nr
Match: XP_011655840.1 (cytochrome P450 77A3 [Cucumis sativus] >KGN52206.1 hypothetical protein Csa_008137 [Cucumis sativus]) HSP 1 Score: 62.0 bits (149), Expect = 2.0e-06 Identity = 31/44 (70.45%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of MELO3C034929.1 vs. NCBI nr
Match: KAA0034667.1 (cytochrome P450 77A3-like [Cucumis melo var. makuwa] >TYK09218.1 cytochrome P450 77A3-like [Cucumis melo var. makuwa]) HSP 1 Score: 61.6 bits (148), Expect = 2.6e-06 Identity = 30/44 (68.18%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of MELO3C034929.1 vs. NCBI nr
Match: XP_008446777.2 (PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3-like [Cucumis melo]) HSP 1 Score: 61.6 bits (148), Expect = 2.6e-06 Identity = 30/44 (68.18%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of MELO3C034929.1 vs. NCBI nr
Match: KAA0063230.1 (glucose-induced degradation protein 8-like protein [Cucumis melo var. makuwa] >TYK13480.1 glucose-induced degradation protein 8-like protein [Cucumis melo var. makuwa]) HSP 1 Score: 56.6 bits (135), Expect = 8.3e-05 Identity = 26/35 (74.29%), Postives = 27/35 (77.14%), Query Frame = 0
BLAST of MELO3C034929.1 vs. ExPASy TrEMBL
Match: A0A5A7UUQ5 (Cytochrome P450 77A3-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold886G00660 PE=4 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 1.6e-14 Identity = 43/53 (81.13%), Postives = 44/53 (83.02%), Query Frame = 0
BLAST of MELO3C034929.1 vs. ExPASy TrEMBL
Match: A0A0A0KWN5 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G615280 PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 9.6e-07 Identity = 31/44 (70.45%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of MELO3C034929.1 vs. ExPASy TrEMBL
Match: A0A5D3CDE2 (Cytochrome P450 77A3-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold475G002110 PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 1.3e-06 Identity = 30/44 (68.18%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of MELO3C034929.1 vs. ExPASy TrEMBL
Match: A0A1S3BGP7 (LOW QUALITY PROTEIN: cytochrome P450 77A3-like OS=Cucumis melo OX=3656 GN=LOC103489405 PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 1.3e-06 Identity = 30/44 (68.18%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of MELO3C034929.1 vs. ExPASy TrEMBL
Match: A0A5A7V7L0 (Glucose-induced degradation protein 8-like protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold556G00130 PE=4 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 4.0e-05 Identity = 26/35 (74.29%), Postives = 27/35 (77.14%), Query Frame = 0
BLAST of MELO3C034929.1 vs. TAIR 10
Match: AT3G10570.1 (cytochrome P450, family 77, subfamily A, polypeptide 6 ) HSP 1 Score: 47.0 bits (110), Expect = 6.2e-06 Identity = 20/40 (50.00%), Postives = 28/40 (70.00%), Query Frame = 0
BLAST of MELO3C034929.1 vs. TAIR 10
Match: AT5G04660.1 (cytochrome P450, family 77, subfamily A, polypeptide 4 ) HSP 1 Score: 45.4 bits (106), Expect = 1.8e-05 Identity = 21/38 (55.26%), Postives = 26/38 (68.42%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|