![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MELO3C031130.jh1.t1 (mRNA) Melon (Harukei-3) v1.41
Overview
Sequences
The following sequences are available for this feature:
Legend: exonstart_codonCDSpolypeptidestop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCACTTTCTAAGTCGCAAACAACTAAAGGTATATGGTTGGCTAGATGCGCCGGCATCGAGCCTTGTACACTTGTAATGGATTTGGAAGGAACTGATGGAAGAGAGCGAGGAGAGGTGCATTTCTATGCCCTTTTTGGTTTTCATGTGTTTCTTTTGTTTGTACTTTCGTTTATTTTTGCCTTTTTTATTATTTATTATTTCTTATTTTTTATATTTTCACAAATGTGTTTGTCAATGTTTTGAATTCAGTATATCATTGCATGCTTCTTTTTCCAAATACACATGTATATGTATGTCTGTATGTGTGTGTATGTAAGGATGTGTGTGTGTGTGTATGTTTATGTATGTATTTATGCAAACATACTTATTTTTTTTGTATCATATCAAGCTAAGATGTATACTTTGGTTGTTTCTTAATTTTCTTTTGTCACATTCTTTTTAAGGACGACACTGCATTTGAGAAGCAAAGTGCCCTCTTTGCGCTTGGTGTGTAA ATGTCACTTTCTAAGTCGCAAACAACTAAAGGTATATGGTTGGCTAGATGCGCCGGCATCGAGCCTTGTACACTTGTAATGGATTTGGAAGGAACTGATGGAAGAGAGCGAGGAGAGGACGACACTGCATTTGAGAAGCAAAGTGCCCTCTTTGCGCTTGGTGTGTAA ATGTCACTTTCTAAGTCGCAAACAACTAAAGGTATATGGTTGGCTAGATGCGCCGGCATCGAGCCTTGTACACTTGTAATGGATTTGGAAGGAACTGATGGAAGAGAGCGAGGAGAGGACGACACTGCATTTGAGAAGCAAAGTGCCCTCTTTGCGCTTGGTGTGTAA MSLSKSQTTKGIWLARCAGIEPCTLVMDLEGTDGRERGEDDTAFEKQSALFALGV Homology
BLAST of MELO3C031130.jh1.t1 vs. NCBI nr
Match: KAF2301062.1 (hypothetical protein GH714_019756 [Hevea brasiliensis]) HSP 1 Score: 105 bits (263), Expect = 2.40e-27 Identity = 49/51 (96.08%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. NCBI nr
Match: KAG2321814.1 (hypothetical protein Bca52824_015027 [Brassica carinata]) HSP 1 Score: 105 bits (262), Expect = 1.36e-26 Identity = 48/51 (94.12%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. NCBI nr
Match: MCH81464.1 (ROOT HAIR defective 3 GTP-binding family protein [Trifolium medium]) HSP 1 Score: 104 bits (259), Expect = 1.48e-26 Identity = 47/51 (92.16%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. NCBI nr
Match: KAF5929889.1 (hypothetical protein HYC85_000056, partial [Camellia sinensis]) HSP 1 Score: 104 bits (260), Expect = 4.74e-26 Identity = 48/51 (94.12%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. NCBI nr
Match: KAG5537881.1 (hypothetical protein RHGRI_025094 [Rhododendron griersonianum]) HSP 1 Score: 108 bits (270), Expect = 6.11e-26 Identity = 50/55 (90.91%), Postives = 53/55 (96.36%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. ExPASy Swiss-Prot
Match: Q9SSN0 (Protein ROOT HAIR DEFECTIVE 3 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=At1g72960 PE=2 SV=2) HSP 1 Score: 105.5 bits (262), Expect = 1.9e-22 Identity = 48/51 (94.12%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. ExPASy Swiss-Prot
Match: P93042 (Protein ROOT HAIR DEFECTIVE 3 OS=Arabidopsis thaliana OX=3702 GN=RHD3 PE=1 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 5.6e-22 Identity = 47/51 (92.16%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. ExPASy Swiss-Prot
Match: Q2QMH2 (Protein ROOT HAIR DEFECTIVE 3 homolog 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os12g0604600 PE=2 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 6.2e-21 Identity = 43/51 (84.31%), Postives = 49/51 (96.08%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. ExPASy Swiss-Prot
Match: Q0JLS6 (Protein ROOT HAIR DEFECTIVE 3 OS=Oryza sativa subsp. japonica OX=39947 GN=RHD3 PE=2 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.5e-19 Identity = 44/51 (86.27%), Postives = 47/51 (92.16%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. ExPASy Swiss-Prot
Match: Q9FKE9 (Protein ROOT HAIR DEFECTIVE 3 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=At5g45160 PE=2 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 3.4e-19 Identity = 42/51 (82.35%), Postives = 46/51 (90.20%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. ExPASy TrEMBL
Match: A0A6A6LI26 (GB1/RHD3-type G domain-containing protein OS=Hevea brasiliensis OX=3981 GN=GH714_019756 PE=3 SV=1) HSP 1 Score: 105 bits (263), Expect = 1.16e-27 Identity = 49/51 (96.08%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. ExPASy TrEMBL
Match: A0A392M506 (ROOT HAIR defective 3 GTP-binding family protein (Fragment) OS=Trifolium medium OX=97028 GN=A2U01_0002251 PE=3 SV=1) HSP 1 Score: 104 bits (259), Expect = 7.18e-27 Identity = 47/51 (92.16%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. ExPASy TrEMBL
Match: A0A7J7FPD9 (GB1/RHD3-type G domain-containing protein (Fragment) OS=Camellia sinensis OX=4442 GN=HYC85_000056 PE=3 SV=1) HSP 1 Score: 104 bits (260), Expect = 2.30e-26 Identity = 48/51 (94.12%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. ExPASy TrEMBL
Match: A0A2I0K194 (GB1/RHD3-type G domain-containing protein OS=Punica granatum OX=22663 GN=CRG98_017325 PE=3 SV=1) HSP 1 Score: 105 bits (263), Expect = 4.36e-26 Identity = 49/51 (96.08%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. ExPASy TrEMBL
Match: A0A7J7GWR8 (GB1/RHD3-type G domain-containing protein OS=Camellia sinensis OX=4442 GN=HYC85_018001 PE=3 SV=1) HSP 1 Score: 102 bits (255), Expect = 1.23e-25 Identity = 47/50 (94.00%), Postives = 49/50 (98.00%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. TAIR 10
Match: AT1G72960.1 (Root hair defective 3 GTP-binding protein (RHD3) ) HSP 1 Score: 105.5 bits (262), Expect = 1.4e-23 Identity = 48/51 (94.12%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. TAIR 10
Match: AT3G13870.1 (Root hair defective 3 GTP-binding protein (RHD3) ) HSP 1 Score: 104.0 bits (258), Expect = 4.0e-23 Identity = 47/51 (92.16%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. TAIR 10
Match: AT3G13870.2 (Root hair defective 3 GTP-binding protein (RHD3) ) HSP 1 Score: 102.8 bits (255), Expect = 8.8e-23 Identity = 47/50 (94.00%), Postives = 49/50 (98.00%), Query Frame = 0
BLAST of MELO3C031130.jh1.t1 vs. TAIR 10
Match: AT5G45160.1 (Root hair defective 3 GTP-binding protein (RHD3) ) HSP 1 Score: 94.7 bits (234), Expect = 2.4e-20 Identity = 42/51 (82.35%), Postives = 46/51 (90.20%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Harukei-3) v1.41
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|