MELO3C027179.1 (mRNA) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GGTTTTCCTGAAATTTTGCGAGGAGTTTCCTTGAATGAATACACAAGAAAGTATGCCCCTCCATTCGATGAATTCGAAGTGGATCGCTGTATTCTCCCACAAGCTGCATCCGTGTCCTTCCCATCCGTCCCAGGACCTTCTCTCTTTCTAGTGATGTCCGGAAAAGGGACAATTATCACAAGCTATTCCGAAGAAACTACATTTCAAGAAGGTGAAGTTCTGTTCGTTCCAGCATATATGGAAGTGAGTATAACAGCTACAGCTATAGAATTACATATGTACAGAGCTGGGATCAACAACAGATTCTTTCGAGACTTATGA GGTTTTCCTGAAATTTTGCGAGGAGTTTCCTTGAATGAATACACAAGAAAGTATGCCCCTCCATTCGATGAATTCGAAGTGGATCGCTGTATTCTCCCACAAGCTGCATCCGTGTCCTTCCCATCCGTCCCAGGACCTTCTCTCTTTCTAGTGATGTCCGGAAAAGGGACAATTATCACAAGCTATTCCGAAGAAACTACATTTCAAGAAGGTGAAGTTCTGTTCGTTCCAGCATATATGGAAGTGAGTATAACAGCTACAGCTATAGAATTACATATGTACAGAGCTGGGATCAACAACAGATTCTTTCGAGACTTATGA GGTTTTCCTGAAATTTTGCGAGGAGTTTCCTTGAATGAATACACAAGAAAGTATGCCCCTCCATTCGATGAATTCGAAGTGGATCGCTGTATTCTCCCACAAGCTGCATCCGTGTCCTTCCCATCCGTCCCAGGACCTTCTCTCTTTCTAGTGATGTCCGGAAAAGGGACAATTATCACAAGCTATTCCGAAGAAACTACATTTCAAGAAGGTGAAGTTCTGTTCGTTCCAGCATATATGGAAGTGAGTATAACAGCTACAGCTATAGAATTACATATGTACAGAGCTGGGATCAACAACAGATTCTTTCGAGACTTATGA GFPEILRGVSLNEYTRKYAPPFDEFEVDRCILPQAASVSFPSVPGPSLFLVMSGKGTIITSYSEETTFQEGEVLFVPAYMEVSITATAIELHMYRAGINNRFFRDL Homology
BLAST of MELO3C027179.1 vs. NCBI nr
Match: XP_004143675.1 (mannose-6-phosphate isomerase 1 [Cucumis sativus] >XP_011654856.1 mannose-6-phosphate isomerase 1 [Cucumis sativus] >KGN50328.1 hypothetical protein Csa_000669 [Cucumis sativus]) HSP 1 Score: 212.6 bits (540), Expect = 1.6e-51 Identity = 104/106 (98.11%), Postives = 104/106 (98.11%), Query Frame = 0
BLAST of MELO3C027179.1 vs. NCBI nr
Match: XP_038875726.1 (mannose-6-phosphate isomerase 1-like [Benincasa hispida] >XP_038875727.1 mannose-6-phosphate isomerase 1-like [Benincasa hispida] >XP_038875728.1 mannose-6-phosphate isomerase 1-like [Benincasa hispida] >XP_038875729.1 mannose-6-phosphate isomerase 1-like [Benincasa hispida]) HSP 1 Score: 205.7 bits (522), Expect = 2.0e-49 Identity = 99/106 (93.40%), Postives = 102/106 (96.23%), Query Frame = 0
BLAST of MELO3C027179.1 vs. NCBI nr
Match: XP_023511752.1 (mannose-6-phosphate isomerase 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 204.5 bits (519), Expect = 4.4e-49 Identity = 97/106 (91.51%), Postives = 102/106 (96.23%), Query Frame = 0
BLAST of MELO3C027179.1 vs. NCBI nr
Match: XP_022971761.1 (mannose-6-phosphate isomerase 1-like [Cucurbita maxima]) HSP 1 Score: 203.0 bits (515), Expect = 1.3e-48 Identity = 96/106 (90.57%), Postives = 102/106 (96.23%), Query Frame = 0
BLAST of MELO3C027179.1 vs. NCBI nr
Match: XP_022921753.1 (mannose-6-phosphate isomerase 1-like [Cucurbita moschata]) HSP 1 Score: 201.1 bits (510), Expect = 4.9e-48 Identity = 95/106 (89.62%), Postives = 101/106 (95.28%), Query Frame = 0
BLAST of MELO3C027179.1 vs. ExPASy Swiss-Prot
Match: Q9FZH5 (Mannose-6-phosphate isomerase 2 OS=Arabidopsis thaliana OX=3702 GN=PMI2 PE=1 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 2.7e-25 Identity = 53/106 (50.00%), Postives = 74/106 (69.81%), Query Frame = 0
BLAST of MELO3C027179.1 vs. ExPASy Swiss-Prot
Match: Q9M884 (Mannose-6-phosphate isomerase 1 OS=Arabidopsis thaliana OX=3702 GN=PMI1 PE=1 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 7.4e-23 Identity = 53/102 (51.96%), Postives = 71/102 (69.61%), Query Frame = 0
BLAST of MELO3C027179.1 vs. ExPASy Swiss-Prot
Match: Q9GP38 (Probable mannose-6-phosphate isomerase OS=Echinococcus multilocularis OX=6211 GN=PMIH PE=2 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 1.8e-05 Identity = 34/95 (35.79%), Postives = 49/95 (51.58%), Query Frame = 0
BLAST of MELO3C027179.1 vs. ExPASy TrEMBL
Match: A0A0A0KL16 (Mannose-6-phosphate isomerase OS=Cucumis sativus OX=3659 GN=Csa_5G167200 PE=3 SV=1) HSP 1 Score: 212.6 bits (540), Expect = 7.9e-52 Identity = 104/106 (98.11%), Postives = 104/106 (98.11%), Query Frame = 0
BLAST of MELO3C027179.1 vs. ExPASy TrEMBL
Match: A0A6J1I443 (Mannose-6-phosphate isomerase OS=Cucurbita maxima OX=3661 GN=LOC111470445 PE=3 SV=1) HSP 1 Score: 203.0 bits (515), Expect = 6.3e-49 Identity = 96/106 (90.57%), Postives = 102/106 (96.23%), Query Frame = 0
BLAST of MELO3C027179.1 vs. ExPASy TrEMBL
Match: A0A6J1E4R0 (Mannose-6-phosphate isomerase OS=Cucurbita moschata OX=3662 GN=LOC111429906 PE=3 SV=1) HSP 1 Score: 201.1 bits (510), Expect = 2.4e-48 Identity = 95/106 (89.62%), Postives = 101/106 (95.28%), Query Frame = 0
BLAST of MELO3C027179.1 vs. ExPASy TrEMBL
Match: A0A6J1FJN3 (Mannose-6-phosphate isomerase OS=Cucurbita moschata OX=3662 GN=LOC111444656 PE=3 SV=1) HSP 1 Score: 197.6 bits (501), Expect = 2.6e-47 Identity = 95/106 (89.62%), Postives = 101/106 (95.28%), Query Frame = 0
BLAST of MELO3C027179.1 vs. ExPASy TrEMBL
Match: A0A6J1K047 (Mannose-6-phosphate isomerase OS=Cucurbita maxima OX=3661 GN=LOC111489838 PE=3 SV=1) HSP 1 Score: 190.3 bits (482), Expect = 4.2e-45 Identity = 92/105 (87.62%), Postives = 98/105 (93.33%), Query Frame = 0
BLAST of MELO3C027179.1 vs. TAIR 10
Match: AT1G67070.1 (Mannose-6-phosphate isomerase, type I ) HSP 1 Score: 115.9 bits (289), Expect = 1.9e-26 Identity = 53/106 (50.00%), Postives = 74/106 (69.81%), Query Frame = 0
BLAST of MELO3C027179.1 vs. TAIR 10
Match: AT3G02570.1 (Mannose-6-phosphate isomerase, type I ) HSP 1 Score: 107.8 bits (268), Expect = 5.3e-24 Identity = 53/102 (51.96%), Postives = 71/102 (69.61%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|