
MELO3C001345.1 (mRNA) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TACGTCCCTTTTAACGCTGGGCCCGACTCCATTGAGTGCTACTCTCTCGACGAGATCGTTTACCGAAGCCGATCTGGTGGGTTACTCGACATTCAATACGACATGAAGGCATTGAAGAAATATGACGGCGCCTATTGGCGAAACCTCTTCGATTCGCGCGTGGGGAAAACTACGTGGCCTTATGGTTCCGGCGTTTGGAGTAAGAAGGAATGG TACGTCCCTTTTAACGCTGGGCCCGACTCCATTGAGTGCTACTCTCTCGACGAGATCGTTTACCGAAGCCGATCTGGTGGGTTACTCGACATTCAATACGACATGAAGGCATTGAAGAAATATGACGGCGCCTATTGGCGAAACCTCTTCGATTCGCGCGTGGGGAAAACTACGTGGCCTTATGGTTCCGGCGTTTGGAGTAAGAAGGAATGG TACGTCCCTTTTAACGCTGGGCCCGACTCCATTGAGTGCTACTCTCTCGACGAGATCGTTTACCGAAGCCGATCTGGTGGGTTACTCGACATTCAATACGACATGAAGGCATTGAAGAAATATGACGGCGCCTATTGGCGAAACCTCTTCGATTCGCGCGTGGGGAAAACTACGTGGCCTTATGGTTCCGGCGTTTGGAGTAAGAAGGAATGG YVPFNAGPDSIECYSLDEIVYRSRSGGLLDIQYDMKALKKYDGAYWRNLFDSRVGKTTWPYGSGVWSKKEW Homology
BLAST of MELO3C001345.1 vs. ExPASy Swiss-Prot
Match: Q9MT28 (Threonine synthase, chloroplastic OS=Solanum tuberosum OX=4113 PE=2 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 1.2e-32 Identity = 62/71 (87.32%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of MELO3C001345.1 vs. ExPASy Swiss-Prot
Match: Q9S7B5 (Threonine synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TS1 PE=1 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 1.0e-31 Identity = 59/71 (83.10%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of MELO3C001345.1 vs. ExPASy Swiss-Prot
Match: Q9SSP5 (Threonine synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TS2 PE=1 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 7.2e-30 Identity = 57/71 (80.28%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MELO3C001345.1 vs. NCBI nr
Match: KAA0054405.1 (Tryptophan synthase beta subunit-like PLP-dependent enzymes superfamily [Cucumis melo var. makuwa] >TYJ96832.1 Tryptophan synthase beta subunit-like PLP-dependent enzymes superfamily [Cucumis melo var. makuwa]) HSP 1 Score: 158.7 bits (400), Expect = 1.9e-35 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 0
BLAST of MELO3C001345.1 vs. NCBI nr
Match: XP_011660008.1 (threonine synthase, chloroplastic [Cucumis sativus] >KGN66271.1 hypothetical protein Csa_006965 [Cucumis sativus]) HSP 1 Score: 153.3 bits (386), Expect = 7.9e-34 Identity = 68/71 (95.77%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MELO3C001345.1 vs. NCBI nr
Match: TYK10051.1 (threonine synthase 1 [Cucumis melo var. makuwa]) HSP 1 Score: 153.3 bits (386), Expect = 7.9e-34 Identity = 68/71 (95.77%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MELO3C001345.1 vs. NCBI nr
Match: TYK27135.1 (threonine synthase 1 [Cucumis melo var. makuwa]) HSP 1 Score: 153.3 bits (386), Expect = 7.9e-34 Identity = 68/71 (95.77%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MELO3C001345.1 vs. NCBI nr
Match: KAA0057146.1 (threonine synthase 1 [Cucumis melo var. makuwa]) HSP 1 Score: 153.3 bits (386), Expect = 7.9e-34 Identity = 68/71 (95.77%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MELO3C001345.1 vs. ExPASy TrEMBL
Match: A0A5A7UL45 (Tryptophan synthase beta subunit-like PLP-dependent enzymes superfamily OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold2750G00290 PE=4 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 9.1e-36 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 0
BLAST of MELO3C001345.1 vs. ExPASy TrEMBL
Match: A0A5A7UJB3 (Pyridoxal-5'-phosphate-dependent enzyme family protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold319G001880 PE=4 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 3.8e-34 Identity = 68/71 (95.77%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MELO3C001345.1 vs. ExPASy TrEMBL
Match: A0A5A7UKY2 (Threonine synthase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold181G001890 PE=3 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 3.8e-34 Identity = 68/71 (95.77%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MELO3C001345.1 vs. ExPASy TrEMBL
Match: A0A5D3CDZ3 (Threonine synthase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold16G001840 PE=3 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 3.8e-34 Identity = 68/71 (95.77%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MELO3C001345.1 vs. ExPASy TrEMBL
Match: A0A5A7USK5 (Threonine synthase 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold741G00070 PE=4 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 3.8e-34 Identity = 68/71 (95.77%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MELO3C001345.1 vs. TAIR 10
Match: AT4G29840.1 (Pyridoxal-5'-phosphate-dependent enzyme family protein ) HSP 1 Score: 136.7 bits (343), Expect = 7.1e-33 Identity = 59/71 (83.10%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of MELO3C001345.1 vs. TAIR 10
Match: AT1G72810.1 (Pyridoxal-5'-phosphate-dependent enzyme family protein ) HSP 1 Score: 130.6 bits (327), Expect = 5.1e-31 Identity = 57/71 (80.28%), Postives = 62/71 (87.32%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|