MELO.jh017989.1.t1 (mRNA) Melon (Harukei-3) v1.41
Overview
Sequences
The following sequences are available for this feature:
Legend: exonstart_codonCDSpolypeptidestop_codon Hold the cursor over a type above to highlight its positions in the sequence below.CAGTCATAGAGATTTGTGTGTGTTAAAAGAAAGTAAGGTAAGAAAATGTGTTCCCAAGTGCTTGGAGGTTACTTTCCATGTCGGGATCCACAAGATCAACATGTGAAAGAGGTCGCAGAATGGGCAGTGGAAAAATACAACGAACGAGGTCATCACTTGACCCTTGTTAGTATATTGGATTGTGAGTCGCAAGTGGTGTCCGGAACCAATTGGCGTCTTCTGTTGAAGTGTAAGGATGAAAACAATTGTGAGAATCACTACTATCAGATTGTTGTGTATGAGAAGCCATGGGAACATTTAAGGGAGCTCATTTCCTTCTATCGTCTCTACCCACATGAATAAACCAACTCCCTACTTAAACTTATTGCTTTTATGCATATGTATGTTATGTACTTCCCCTCCTTAAGGATCAATAATATATAGATCAATAAATAATGGGATTATAAAATAAA CAGTCATAGAGATTTGTGTGTGTTAAAAGAAAGTAAGGTAAGAAAATGTGTTCCCAAGTGCTTGGAGGTTACTTTCCATGTCGGGATCCACAAGATCAACATGTGAAAGAGGTCGCAGAATGGGCAGTGGAAAAATACAACGAACGAGGTCATCACTTGACCCTTGTTAGTATATTGGATTGTGAGTCGCAAGTGGTGTCCGGAACCAATTGGCGTCTTCTGTTGAAGTGTAAGGATGAAAACAATTGTGAGAATCACTACTATCAGATTGTTGTGTATGAGAAGCCATGGGAACATTTAAGGGAGCTCATTTCCTTCTATCGTCTCTACCCACATGAATAAACCAACTCCCTACTTAAACTTATTGCTTTTATGCATATGTATGTTATGTACTTCCCCTCCTTAAGGATCAATAATATATAGATCAATAAATAATGGGATTATAAAATAAA ATGTGTTCCCAAGTGCTTGGAGGTTACTTTCCATGTCGGGATCCACAAGATCAACATGTGAAAGAGGTCGCAGAATGGGCAGTGGAAAAATACAACGAACGAGGTCATCACTTGACCCTTGTTAGTATATTGGATTGTGAGTCGCAAGTGGTGTCCGGAACCAATTGGCGTCTTCTGTTGAAGTGTAAGGATGAAAACAATTGTGAGAATCACTACTATCAGATTGTTGTGTATGAGAAGCCATGGGAACATTTAAGGGAGCTCATTTCCTTCTATCGTCTCTACCCACATGAATAA MCSQVLGGYFPCRDPQDQHVKEVAEWAVEKYNERGHHLTLVSILDCESQVVSGTNWRLLLKCKDENNCENHYYQIVVYEKPWEHLRELISFYRLYPHE Homology
BLAST of MELO.jh017989.1.t1 vs. NCBI nr
Match: KAA0032421.1 (cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa]) HSP 1 Score: 154 bits (390), Expect = 1.24e-46 Identity = 70/98 (71.43%), Postives = 80/98 (81.63%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. NCBI nr
Match: KAA0025174.1 (cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa] >KAA0036719.1 cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa]) HSP 1 Score: 152 bits (385), Expect = 7.42e-46 Identity = 70/99 (70.71%), Postives = 82/99 (82.83%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. NCBI nr
Match: KAA0025171.1 (cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa]) HSP 1 Score: 152 bits (384), Expect = 1.02e-45 Identity = 69/98 (70.41%), Postives = 80/98 (81.63%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. NCBI nr
Match: KAA0040727.1 (cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa]) HSP 1 Score: 151 bits (381), Expect = 2.93e-45 Identity = 69/98 (70.41%), Postives = 78/98 (79.59%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. NCBI nr
Match: KAA0048649.1 (cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa]) HSP 1 Score: 145 bits (367), Expect = 3.65e-43 Identity = 67/98 (68.37%), Postives = 78/98 (79.59%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 63.9 bits (154), Expect = 1.1e-09 Identity = 34/87 (39.08%), Postives = 51/87 (58.62%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 62.0 bits (149), Expect = 4.3e-09 Identity = 33/89 (37.08%), Postives = 56/89 (62.92%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 5.6e-09 Identity = 33/89 (37.08%), Postives = 55/89 (61.80%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 3.7e-08 Identity = 32/88 (36.36%), Postives = 48/88 (54.55%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 4.0e-07 Identity = 29/86 (33.72%), Postives = 45/86 (52.33%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. ExPASy TrEMBL
Match: A0A5A7SS93 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold2492G00020 PE=4 SV=1) HSP 1 Score: 154 bits (390), Expect = 6.02e-47 Identity = 70/98 (71.43%), Postives = 80/98 (81.63%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. ExPASy TrEMBL
Match: A0A5A7SHR8 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold48601G00010 PE=4 SV=1) HSP 1 Score: 152 bits (385), Expect = 3.59e-46 Identity = 70/99 (70.71%), Postives = 82/99 (82.83%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. ExPASy TrEMBL
Match: A0A5A7SLP1 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold541G00100 PE=4 SV=1) HSP 1 Score: 152 bits (384), Expect = 4.95e-46 Identity = 69/98 (70.41%), Postives = 80/98 (81.63%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. ExPASy TrEMBL
Match: A0A5A7TGL3 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold529G00530 PE=4 SV=1) HSP 1 Score: 151 bits (381), Expect = 1.42e-45 Identity = 69/98 (70.41%), Postives = 78/98 (79.59%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. ExPASy TrEMBL
Match: A0A5A7U5C4 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold10755G00010 PE=4 SV=1) HSP 1 Score: 145 bits (367), Expect = 1.77e-43 Identity = 67/98 (68.37%), Postives = 78/98 (79.59%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 63.9 bits (154), Expect = 8.1e-11 Identity = 34/87 (39.08%), Postives = 51/87 (58.62%), Query Frame = 0
BLAST of MELO.jh017989.1.t1 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 52.0 bits (123), Expect = 3.2e-07 Identity = 33/90 (36.67%), Postives = 49/90 (54.44%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Harukei-3) v1.41
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|