
MC11g1103.1 (mRNA) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GCTTGTCCTGTGAACTTTGAGTTCTTGAACTACACCATCATCACAAGCAGGTGCAAGGGGCCTCAATACCCTACCGATCTCTGTTGCCCAGCTTTGACAGATTTCGCTTGCCCTTACGCCGAGGAACTCAACGACTTATCTAATGATTGCTCTTCAACCATGTTCAGTTACATTAACCTGTATGGAAAATACCCTCCTGGTCTTTTCTCTAGCGAGTGCCGGGCTGGGAAGGAAGGTCTGCCATGCCCTGCACAACCGCCCTCCACTTCATCCGATCTAAACTGGGGTTCAATAACAAGTTTCCCATCTCGTTCGCTGTTCCTCGTGGCTGGATTCGTACTTCTGTCTTGGCTATTA GCTTGTCCTGTGAACTTTGAGTTCTTGAACTACACCATCATCACAAGCAGGTGCAAGGGGCCTCAATACCCTACCGATCTCTGTTGCCCAGCTTTGACAGATTTCGCTTGCCCTTACGCCGAGGAACTCAACGACTTATCTAATGATTGCTCTTCAACCATGTTCAGTTACATTAACCTGTATGGAAAATACCCTCCTGGTCTTTTCTCTAGCGAGTGCCGGGCTGGGAAGGAAGGTCTGCCATGCCCTGCACAACCGCCCTCCACTTCATCCGATCTAAACTGGGGTTCAATAACAAGTTTCCCATCTCGTTCGCTGTTCCTCGTGGCTGGATTCGTACTTCTGTCTTGGCTATTA GCTTGTCCTGTGAACTTTGAGTTCTTGAACTACACCATCATCACAAGCAGGTGCAAGGGGCCTCAATACCCTACCGATCTCTGTTGCCCAGCTTTGACAGATTTCGCTTGCCCTTACGCCGAGGAACTCAACGACTTATCTAATGATTGCTCTTCAACCATGTTCAGTTACATTAACCTGTATGGAAAATACCCTCCTGGTCTTTTCTCTAGCGAGTGCCGGGCTGGGAAGGAAGGTCTGCCATGCCCTGCACAACCGCCCTCCACTTCATCCGATCTAAACTGGGGTTCAATAACAAGTTTCCCATCTCGTTCGCTGTTCCTCGTGGCTGGATTCGTACTTCTGTCTTGGCTATTA ACPVNFEFLNYTIITSRCKGPQYPTDLCCPALTDFACPYAEELNDLSNDCSSTMFSYINLYGKYPPGLFSSECRAGKEGLPCPAQPPSTSSDLNWGSITSFPSRSLFLVAGFVLLSWLL Homology
BLAST of MC11g1103.1 vs. ExPASy Swiss-Prot
Match: Q9FKT1 (GPI-anchored protein LLG1 OS=Arabidopsis thaliana OX=3702 GN=LLG1 PE=1 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 7.0e-38 Identity = 72/117 (61.54%), Postives = 92/117 (78.63%), Query Frame = 0
BLAST of MC11g1103.1 vs. ExPASy Swiss-Prot
Match: Q6NLF4 (GPI-anchored protein LLG2 OS=Arabidopsis thaliana OX=3702 GN=LLG2 PE=1 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 2.4e-30 Identity = 66/119 (55.46%), Postives = 79/119 (66.39%), Query Frame = 0
BLAST of MC11g1103.1 vs. ExPASy Swiss-Prot
Match: Q9M0I0 (GPI-anchored protein LLG3 OS=Arabidopsis thaliana OX=3702 GN=LLG3 PE=2 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 7.0e-30 Identity = 56/90 (62.22%), Postives = 68/90 (75.56%), Query Frame = 0
BLAST of MC11g1103.1 vs. ExPASy Swiss-Prot
Match: B3GS44 (GPI-anchored protein LORELEI OS=Arabidopsis thaliana OX=3702 GN=LRE PE=1 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 6.0e-29 Identity = 56/118 (47.46%), Postives = 79/118 (66.95%), Query Frame = 0
BLAST of MC11g1103.1 vs. NCBI nr
Match: XP_022139788.1 (GPI-anchored protein LLG1-like [Momordica charantia]) HSP 1 Score: 255 bits (652), Expect = 3.36e-85 Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 0
BLAST of MC11g1103.1 vs. NCBI nr
Match: XP_022936417.1 (GPI-anchored protein LLG1 [Cucurbita moschata]) HSP 1 Score: 213 bits (543), Expect = 1.37e-68 Identity = 95/119 (79.83%), Postives = 107/119 (89.92%), Query Frame = 0
BLAST of MC11g1103.1 vs. NCBI nr
Match: XP_022976292.1 (GPI-anchored protein LLG1-like [Cucurbita maxima]) HSP 1 Score: 212 bits (540), Expect = 3.93e-68 Identity = 95/119 (79.83%), Postives = 106/119 (89.08%), Query Frame = 0
BLAST of MC11g1103.1 vs. NCBI nr
Match: KAG6592129.1 (GPI-anchored protein LLG1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 211 bits (538), Expect = 7.92e-68 Identity = 94/119 (78.99%), Postives = 106/119 (89.08%), Query Frame = 0
BLAST of MC11g1103.1 vs. NCBI nr
Match: KAG7025004.1 (GPI-anchored protein LLG1 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 211 bits (538), Expect = 7.92e-68 Identity = 94/119 (78.99%), Postives = 106/119 (89.08%), Query Frame = 0
BLAST of MC11g1103.1 vs. ExPASy TrEMBL
Match: A0A6J1CGJ1 (GPI-anchored protein LLG1-like OS=Momordica charantia OX=3673 GN=LOC111010609 PE=4 SV=1) HSP 1 Score: 255 bits (652), Expect = 1.63e-85 Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 0
BLAST of MC11g1103.1 vs. ExPASy TrEMBL
Match: A0A6J1F8E1 (GPI-anchored protein LLG1 OS=Cucurbita moschata OX=3662 GN=LOC111443044 PE=4 SV=1) HSP 1 Score: 213 bits (543), Expect = 6.64e-69 Identity = 95/119 (79.83%), Postives = 107/119 (89.92%), Query Frame = 0
BLAST of MC11g1103.1 vs. ExPASy TrEMBL
Match: A0A6J1IFC4 (GPI-anchored protein LLG1-like OS=Cucurbita maxima OX=3661 GN=LOC111476731 PE=4 SV=1) HSP 1 Score: 212 bits (540), Expect = 1.90e-68 Identity = 95/119 (79.83%), Postives = 106/119 (89.08%), Query Frame = 0
BLAST of MC11g1103.1 vs. ExPASy TrEMBL
Match: A0A5D3DHU2 (GPI-anchored protein LORELEI-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold142G002810 PE=4 SV=1) HSP 1 Score: 204 bits (520), Expect = 5.36e-66 Identity = 93/119 (78.15%), Postives = 104/119 (87.39%), Query Frame = 0
BLAST of MC11g1103.1 vs. ExPASy TrEMBL
Match: A0A1S3BIW0 (GPI-anchored protein LORELEI-like OS=Cucumis melo OX=3656 GN=LOC103490187 PE=4 SV=1) HSP 1 Score: 204 bits (520), Expect = 2.11e-65 Identity = 93/119 (78.15%), Postives = 104/119 (87.39%), Query Frame = 0
BLAST of MC11g1103.1 vs. TAIR 10
Match: AT5G56170.1 (LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 ) HSP 1 Score: 157.9 bits (398), Expect = 5.0e-39 Identity = 72/117 (61.54%), Postives = 92/117 (78.63%), Query Frame = 0
BLAST of MC11g1103.1 vs. TAIR 10
Match: AT2G20700.1 (LORELEI-LIKE-GPI ANCHORED PROTEIN 2 ) HSP 1 Score: 132.9 bits (333), Expect = 1.7e-31 Identity = 66/119 (55.46%), Postives = 79/119 (66.39%), Query Frame = 0
BLAST of MC11g1103.1 vs. TAIR 10
Match: AT4G28280.1 (LORELEI-LIKE-GPI ANCHORED PROTEIN 3 ) HSP 1 Score: 132.9 bits (333), Expect = 1.7e-31 Identity = 57/91 (62.64%), Postives = 69/91 (75.82%), Query Frame = 0
BLAST of MC11g1103.1 vs. TAIR 10
Match: AT4G28280.2 (LORELEI-LIKE-GPI ANCHORED PROTEIN 3 ) HSP 1 Score: 131.3 bits (329), Expect = 5.0e-31 Identity = 56/90 (62.22%), Postives = 68/90 (75.56%), Query Frame = 0
BLAST of MC11g1103.1 vs. TAIR 10
Match: AT4G26466.1 (lorelei ) HSP 1 Score: 128.3 bits (321), Expect = 4.2e-30 Identity = 56/118 (47.46%), Postives = 79/118 (66.95%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|