
MC11g1100.1 (mRNA) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CCTGTTATAATAGGAAAGCCTTATATCTTGAAATTAATTCATCAAGTTGATGATAAAATACACGGACGTTCCAGTGGACATTATGCACTTGTTACACAACAACCCCTTAGAGGAAGGGCCAAGCAAGGTGGACAACGGGTGGGAGAAATGGAGACGTTT CCTGTTATAATAGGAAAGCCTTATATCTTGAAATTAATTCATCAAGTTGATGATAAAATACACGGACGTTCCAGTGGACATTATGCACTTGTTACACAACAACCCCTTAGAGGAAGGGCCAAGCAAGGTGGACAACGGGTGGGAGAAATGGAGACGTTT CCTGTTATAATAGGAAAGCCTTATATCTTGAAATTAATTCATCAAGTTGATGATAAAATACACGGACGTTCCAGTGGACATTATGCACTTGTTACACAACAACCCCTTAGAGGAAGGGCCAAGCAAGGTGGACAACGGGTGGGAGAAATGGAGACGTTT PVIIGKPYILKLIHQVDDKIHGRSSGHYALVTQQPLRGRAKQGGQRVGEMETF Homology
BLAST of MC11g1100.1 vs. ExPASy Swiss-Prot
Match: Q8S8X9 (DNA-directed RNA polymerase subunit beta OS=Atropa belladonna OX=33113 GN=rpoB PE=3 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 4.9e-23 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. ExPASy Swiss-Prot
Match: Q4VZP1 (DNA-directed RNA polymerase subunit beta OS=Cucumis sativus OX=3659 GN=rpoB PE=3 SV=2) HSP 1 Score: 107.5 bits (267), Expect = 4.9e-23 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. ExPASy Swiss-Prot
Match: Q0G9X0 (DNA-directed RNA polymerase subunit beta OS=Daucus carota OX=4039 GN=rpoB PE=3 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 4.9e-23 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. ExPASy Swiss-Prot
Match: Q49L06 (DNA-directed RNA polymerase subunit beta OS=Eucalyptus globulus subsp. globulus OX=71271 GN=rpoB PE=3 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 4.9e-23 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. ExPASy Swiss-Prot
Match: Q3C1G7 (DNA-directed RNA polymerase subunit beta OS=Nicotiana sylvestris OX=4096 GN=rpoB PE=3 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 4.9e-23 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. NCBI nr
Match: TLX69649.1 (DNA-directed RNA polymerase subunit beta, partial [Labilibacter sediminis]) HSP 1 Score: 107 bits (267), Expect = 9.83e-28 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. NCBI nr
Match: PHT94084.1 (hypothetical protein T459_01966 [Capsicum annuum]) HSP 1 Score: 106 bits (264), Expect = 9.96e-28 Identity = 50/53 (94.34%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. NCBI nr
Match: WP_199287517.1 (hypothetical protein, partial [Photobacterium chitinilyticum] >RWX52626.1 DNA-directed RNA polymerase subunit beta, partial [Photobacterium chitinilyticum]) HSP 1 Score: 106 bits (264), Expect = 1.55e-27 Identity = 50/53 (94.34%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. NCBI nr
Match: KZN01535.1 (hypothetical protein DCAR_010289 [Daucus carota subsp. sativus]) HSP 1 Score: 107 bits (267), Expect = 2.26e-27 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. NCBI nr
Match: OMP13067.1 (hypothetical protein COLO4_02335, partial [Corchorus olitorius]) HSP 1 Score: 106 bits (264), Expect = 3.18e-27 Identity = 50/53 (94.34%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. ExPASy TrEMBL
Match: A0A5R9QKW6 (DNA-directed RNA polymerase (Fragment) OS=Labilibacter sediminis OX=2570926 GN=E9993_22820 PE=4 SV=1) HSP 1 Score: 107 bits (267), Expect = 4.76e-28 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. ExPASy TrEMBL
Match: A0A2G3AIN2 (DNA-directed RNA polymerase OS=Capsicum annuum OX=4072 GN=T459_01966 PE=3 SV=1) HSP 1 Score: 106 bits (264), Expect = 4.82e-28 Identity = 50/53 (94.34%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. ExPASy TrEMBL
Match: A0A444JHR1 (DNA-directed RNA polymerase (Fragment) OS=Photobacterium chitinilyticum OX=2485123 GN=EDI28_26660 PE=4 SV=1) HSP 1 Score: 106 bits (264), Expect = 7.51e-28 Identity = 50/53 (94.34%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. ExPASy TrEMBL
Match: A0A161WS87 (DNA-directed RNA polymerase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_010289 PE=3 SV=1) HSP 1 Score: 107 bits (267), Expect = 1.10e-27 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. ExPASy TrEMBL
Match: A0A1R3L182 (DNA-directed RNA polymerase (Fragment) OS=Corchorus olitorius OX=93759 GN=COLO4_02335 PE=3 SV=1) HSP 1 Score: 106 bits (264), Expect = 1.54e-27 Identity = 50/53 (94.34%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. TAIR 10
Match: ATCG00190.1 (RNA polymerase subunit beta ) HSP 1 Score: 106.3 bits (264), Expect = 7.7e-24 Identity = 50/53 (94.34%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MC11g1100.1 vs. TAIR 10
Match: AT4G21710.1 (DNA-directed RNA polymerase family protein ) HSP 1 Score: 55.1 bits (131), Expect = 2.0e-08 Identity = 24/50 (48.00%), Postives = 32/50 (64.00%), Query Frame = 0
BLAST of MC11g1100.1 vs. TAIR 10
Match: AT5G45140.1 (nuclear RNA polymerase C2 ) HSP 1 Score: 53.9 bits (128), Expect = 4.5e-08 Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 0
BLAST of MC11g1100.1 vs. TAIR 10
Match: AT1G29940.1 (nuclear RNA polymerase A2 ) HSP 1 Score: 47.0 bits (110), Expect = 5.5e-06 Identity = 22/50 (44.00%), Postives = 30/50 (60.00%), Query Frame = 0
BLAST of MC11g1100.1 vs. TAIR 10
Match: AT3G23780.1 (nuclear RNA polymerase D2A ) HSP 1 Score: 39.7 bits (91), Expect = 8.8e-04 Identity = 17/50 (34.00%), Postives = 31/50 (62.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|