
MC08g2593.1 (mRNA) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AAATCGATTATGGAGGAGCGGGACGAGGAGGAAGACATGAGAGAAGCCTTCAACGTGTTCGACCAGAACGGAGACGGATTCATCACCGATGAATTGAGGTCAGGATTAGCTTCTTTGGGGGTTAAGCAAGGTAGAAGTCCAGAGGATTGCAAGAAGATGATCATGAAGGTGGATGTGGATGGAGATGGAATGGTGAATTACAAAGAATTCAAGCAAATGATGAAGGGAGGTGGGTTTAGTGCATTAGGT AAATCGATTATGGAGGAGCGGGACGAGGAGGAAGACATGAGAGAAGCCTTCAACGTGTTCGACCAGAACGGAGACGGATTCATCACCGATGAATTGAGGTCAGGATTAGCTTCTTTGGGGGTTAAGCAAGGTAGAAGTCCAGAGGATTGCAAGAAGATGATCATGAAGGTGGATGTGGATGGAGATGGAATGGTGAATTACAAAGAATTCAAGCAAATGATGAAGGGAGGTGGGTTTAGTGCATTAGGT AAATCGATTATGGAGGAGCGGGACGAGGAGGAAGACATGAGAGAAGCCTTCAACGTGTTCGACCAGAACGGAGACGGATTCATCACCGATGAATTGAGGTCAGGATTAGCTTCTTTGGGGGTTAAGCAAGGTAGAAGTCCAGAGGATTGCAAGAAGATGATCATGAAGGTGGATGTGGATGGAGATGGAATGGTGAATTACAAAGAATTCAAGCAAATGATGAAGGGAGGTGGGTTTAGTGCATTAGGT KSIMEERDEEEDMREAFNVFDQNGDGFITDELRSGLASLGVKQGRSPEDCKKMIMKVDVDGDGMVNYKEFKQMMKGGGFSALG Homology
BLAST of MC08g2593.1 vs. ExPASy Swiss-Prot
Match: Q9SRR7 (Calmodulin-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=CML3 PE=2 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 3.1e-32 Identity = 71/84 (84.52%), Postives = 79/84 (94.05%), Query Frame = 0
BLAST of MC08g2593.1 vs. ExPASy Swiss-Prot
Match: Q9SU00 (Calmodulin-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=CML2 PE=2 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 2.2e-30 Identity = 66/83 (79.52%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of MC08g2593.1 vs. ExPASy Swiss-Prot
Match: Q9LNE7 (Calmodulin-like protein 7 OS=Arabidopsis thaliana OX=3702 GN=CML7 PE=2 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.6e-28 Identity = 64/84 (76.19%), Postives = 77/84 (91.67%), Query Frame = 0
BLAST of MC08g2593.1 vs. ExPASy Swiss-Prot
Match: Q2QVI1 (Probable calcium-binding protein CML28 OS=Oryza sativa subsp. japonica OX=39947 GN=CML28 PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.6e-25 Identity = 57/77 (74.03%), Postives = 68/77 (88.31%), Query Frame = 0
BLAST of MC08g2593.1 vs. ExPASy Swiss-Prot
Match: O22845 (Calmodulin-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=CML5 PE=2 SV=2) HSP 1 Score: 112.8 bits (281), Expect = 1.8e-24 Identity = 55/74 (74.32%), Postives = 67/74 (90.54%), Query Frame = 0
BLAST of MC08g2593.1 vs. NCBI nr
Match: KAA0044599.1 (calmodulin-like protein 3 [Cucumis melo var. makuwa] >TYK16985.1 calmodulin-like protein 3 [Cucumis melo var. makuwa]) HSP 1 Score: 149 bits (377), Expect = 2.28e-44 Identity = 77/84 (91.67%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of MC08g2593.1 vs. NCBI nr
Match: XP_004152098.1 (calmodulin-like protein 3 [Cucumis sativus] >XP_008453977.1 PREDICTED: calmodulin-like protein 3 [Cucumis melo] >XP_038878708.1 calmodulin-like protein 3 [Benincasa hispida] >KAE8649113.1 hypothetical protein Csa_015095 [Cucumis sativus] >BAI52955.1 calcium-binding EF-hand protein [Citrullus lanatus subsp. vulgaris]) HSP 1 Score: 149 bits (377), Expect = 3.20e-44 Identity = 77/84 (91.67%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of MC08g2593.1 vs. NCBI nr
Match: XP_022979973.1 (calmodulin-like protein 3 [Cucurbita maxima]) HSP 1 Score: 148 bits (374), Expect = 9.16e-44 Identity = 76/84 (90.48%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of MC08g2593.1 vs. NCBI nr
Match: XP_023890833.1 (calmodulin-like protein 3 [Quercus suber] >XP_030939097.1 calmodulin-like protein 3 [Quercus lobata]) HSP 1 Score: 148 bits (374), Expect = 9.16e-44 Identity = 76/84 (90.48%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of MC08g2593.1 vs. NCBI nr
Match: XP_023526445.1 (calmodulin-like protein 3 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 148 bits (374), Expect = 9.44e-44 Identity = 76/84 (90.48%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of MC08g2593.1 vs. ExPASy TrEMBL
Match: A0A5D3CZN0 (Calmodulin-like protein 3 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold130G001270 PE=4 SV=1) HSP 1 Score: 149 bits (377), Expect = 1.10e-44 Identity = 77/84 (91.67%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of MC08g2593.1 vs. ExPASy TrEMBL
Match: D1MWZ5 (Calcium-binding EF-hand protein OS=Citrullus lanatus subsp. vulgaris OX=260674 GN=CitCaEFh PE=2 SV=1) HSP 1 Score: 149 bits (377), Expect = 1.55e-44 Identity = 77/84 (91.67%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of MC08g2593.1 vs. ExPASy TrEMBL
Match: A0A1S3BXJ7 (calmodulin-like protein 3 OS=Cucumis melo OX=3656 GN=LOC103494537 PE=4 SV=1) HSP 1 Score: 149 bits (377), Expect = 1.55e-44 Identity = 77/84 (91.67%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of MC08g2593.1 vs. ExPASy TrEMBL
Match: A0A6J1IXV3 (calmodulin-like protein 3 OS=Cucurbita maxima OX=3661 GN=LOC111479505 PE=4 SV=1) HSP 1 Score: 148 bits (374), Expect = 4.43e-44 Identity = 76/84 (90.48%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of MC08g2593.1 vs. ExPASy TrEMBL
Match: A0A7N2MS21 (Uncharacterized protein OS=Quercus lobata OX=97700 PE=4 SV=1) HSP 1 Score: 148 bits (374), Expect = 4.43e-44 Identity = 76/84 (90.48%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of MC08g2593.1 vs. TAIR 10
Match: AT3G07490.1 (ARF-GAP domain 11 ) HSP 1 Score: 138.7 bits (348), Expect = 2.2e-33 Identity = 71/84 (84.52%), Postives = 79/84 (94.05%), Query Frame = 0
BLAST of MC08g2593.1 vs. TAIR 10
Match: AT4G12860.1 (EF hand calcium-binding protein family ) HSP 1 Score: 132.5 bits (332), Expect = 1.6e-31 Identity = 66/83 (79.52%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of MC08g2593.1 vs. TAIR 10
Match: AT1G05990.1 (EF hand calcium-binding protein family ) HSP 1 Score: 126.3 bits (316), Expect = 1.1e-29 Identity = 64/84 (76.19%), Postives = 77/84 (91.67%), Query Frame = 0
BLAST of MC08g2593.1 vs. TAIR 10
Match: AT2G43290.1 (Calcium-binding EF-hand family protein ) HSP 1 Score: 112.8 bits (281), Expect = 1.3e-25 Identity = 55/74 (74.32%), Postives = 67/74 (90.54%), Query Frame = 0
BLAST of MC08g2593.1 vs. TAIR 10
Match: AT4G03290.1 (EF hand calcium-binding protein family ) HSP 1 Score: 107.8 bits (268), Expect = 4.1e-24 Identity = 58/83 (69.88%), Postives = 72/83 (86.75%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|