![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MC05g0204.1 (mRNA) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAAAACCCAGTCTCCTCTACCTTATTCTCATCCTCTTGGCTGTTGTTTTCCAGCACACCCATTTCTCATTCTGCGATGCGATTCTTGATCTCAGATCTTTGAAGGGCAGCAAAATCGATGTAATGGCAAAAGGGGTTTGCAACCAGAAGATCGGGGAGTGCCTGACTGAGCCAGAAATGGAGTCGGAAACCAGTAGAAGGGTCCTGATGATGCAGAAGAAGTATATAAGCTACGATACTCTTAAGAGGGACATGGTCCCTTGCACAAGGCCAGGGGTTTCATATTATGAATGCCATTCTGGGCCTGCAAATTCCTACGACAGAGGCTGTGAGGTCATTACTAGATGCGCTAGAGATGTGCACGACATTAACACT ATGGCAAAACCCAGTCTCCTCTACCTTATTCTCATCCTCTTGGCTGTTGTTTTCCAGCACACCCATTTCTCATTCTGCGATGCGATTCTTGATCTCAGATCTTTGAAGGGCAGCAAAATCGATGTAATGGCAAAAGGGGTTTGCAACCAGAAGATCGGGGAGTGCCTGACTGAGCCAGAAATGGAGTCGGAAACCAGTAGAAGGGTCCTGATGATGCAGAAGAAGTATATAAGCTACGATACTCTTAAGAGGGACATGGTCCCTTGCACAAGGCCAGGGGTTTCATATTATGAATGCCATTCTGGGCCTGCAAATTCCTACGACAGAGGCTGTGAGGTCATTACTAGATGCGCTAGAGATGTGCACGACATTAACACT ATGGCAAAACCCAGTCTCCTCTACCTTATTCTCATCCTCTTGGCTGTTGTTTTCCAGCACACCCATTTCTCATTCTGCGATGCGATTCTTGATCTCAGATCTTTGAAGGGCAGCAAAATCGATGTAATGGCAAAAGGGGTTTGCAACCAGAAGATCGGGGAGTGCCTGACTGAGCCAGAAATGGAGTCGGAAACCAGTAGAAGGGTCCTGATGATGCAGAAGAAGTATATAAGCTACGATACTCTTAAGAGGGACATGGTCCCTTGCACAAGGCCAGGGGTTTCATATTATGAATGCCATTCTGGGCCTGCAAATTCCTACGACAGAGGCTGTGAGGTCATTACTAGATGCGCTAGAGATGTGCACGACATTAACACT MAKPSLLYLILILLAVVFQHTHFSFCDAILDLRSLKGSKIDVMAKGVCNQKIGECLTEPEMESETSRRVLMMQKKYISYDTLKRDMVPCTRPGVSYYECHSGPANSYDRGCEVITRCARDVHDINT Homology
BLAST of MC05g0204.1 vs. ExPASy Swiss-Prot
Match: Q9LK37 (Protein RALF-like 24 OS=Arabidopsis thaliana OX=3702 GN=RALFL24 PE=3 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 5.5e-25 Identity = 63/118 (53.39%), Postives = 80/118 (67.80%), Query Frame = 0
BLAST of MC05g0204.1 vs. ExPASy Swiss-Prot
Match: Q2HIM9 (Protein RALF-like 31 OS=Arabidopsis thaliana OX=3702 GN=RALFL31 PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 6.1e-24 Identity = 55/88 (62.50%), Postives = 65/88 (73.86%), Query Frame = 0
BLAST of MC05g0204.1 vs. ExPASy Swiss-Prot
Match: Q945T0 (Rapid alkalinization factor OS=Nicotiana tabacum OX=4097 GN=RALF PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 2.0e-14 Identity = 40/76 (52.63%), Postives = 50/76 (65.79%), Query Frame = 0
BLAST of MC05g0204.1 vs. ExPASy Swiss-Prot
Match: Q9MA62 (Protein RALF-like 22 OS=Arabidopsis thaliana OX=3702 GN=RALFL22 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 2.6e-14 Identity = 49/125 (39.20%), Postives = 67/125 (53.60%), Query Frame = 0
BLAST of MC05g0204.1 vs. ExPASy Swiss-Prot
Match: Q9SRY3 (Protein RALF-like 1 OS=Arabidopsis thaliana OX=3702 GN=RALF1 PE=1 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.2e-13 Identity = 39/73 (53.42%), Postives = 48/73 (65.75%), Query Frame = 0
BLAST of MC05g0204.1 vs. NCBI nr
Match: XP_022146989.1 (protein RALF-like 24 isoform X1 [Momordica charantia] >XP_022146990.1 protein RALF-like 24 isoform X1 [Momordica charantia] >XP_022146991.1 protein RALF-like 24 isoform X1 [Momordica charantia] >XP_022146992.1 protein RALF-like 24 isoform X1 [Momordica charantia] >XP_022146993.1 protein RALF-like 24 isoform X1 [Momordica charantia] >XP_022146994.1 protein RALF-like 24 isoform X1 [Momordica charantia]) HSP 1 Score: 257 bits (656), Expect = 2.59e-86 Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 0
BLAST of MC05g0204.1 vs. NCBI nr
Match: KAG6582492.1 (Protein RALF-like 24, partial [Cucurbita argyrosperma subsp. sororia] >KAG7018876.1 Protein RALF-like 24, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 228 bits (581), Expect = 7.12e-75 Identity = 110/126 (87.30%), Postives = 116/126 (92.06%), Query Frame = 0
BLAST of MC05g0204.1 vs. NCBI nr
Match: XP_023526933.1 (protein RALF-like 24 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 228 bits (581), Expect = 1.69e-74 Identity = 110/126 (87.30%), Postives = 116/126 (92.06%), Query Frame = 0
BLAST of MC05g0204.1 vs. NCBI nr
Match: XP_038875978.1 (protein RALF-like 24 [Benincasa hispida] >XP_038875986.1 protein RALF-like 24 [Benincasa hispida] >XP_038875991.1 protein RALF-like 24 [Benincasa hispida] >XP_038876000.1 protein RALF-like 24 [Benincasa hispida] >XP_038876008.1 protein RALF-like 24 [Benincasa hispida]) HSP 1 Score: 223 bits (567), Expect = 9.72e-73 Identity = 106/126 (84.13%), Postives = 114/126 (90.48%), Query Frame = 0
BLAST of MC05g0204.1 vs. NCBI nr
Match: XP_022974738.1 (protein RALF-like 24 [Cucurbita maxima]) HSP 1 Score: 221 bits (564), Expect = 2.79e-72 Identity = 103/126 (81.75%), Postives = 117/126 (92.86%), Query Frame = 0
BLAST of MC05g0204.1 vs. ExPASy TrEMBL
Match: A0A6J1D019 (protein RALF-like 24 isoform X1 OS=Momordica charantia OX=3673 GN=LOC111016050 PE=3 SV=1) HSP 1 Score: 257 bits (656), Expect = 1.25e-86 Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 0
BLAST of MC05g0204.1 vs. ExPASy TrEMBL
Match: A0A6J1IH73 (protein RALF-like 24 OS=Cucurbita maxima OX=3661 GN=LOC111473473 PE=3 SV=1) HSP 1 Score: 221 bits (564), Expect = 1.35e-72 Identity = 103/126 (81.75%), Postives = 117/126 (92.86%), Query Frame = 0
BLAST of MC05g0204.1 vs. ExPASy TrEMBL
Match: A0A1S3AWQ1 (protein RALF-like 24 isoform X1 OS=Cucumis melo OX=3656 GN=LOC103483460 PE=3 SV=1) HSP 1 Score: 217 bits (552), Expect = 9.73e-71 Identity = 106/128 (82.81%), Postives = 114/128 (89.06%), Query Frame = 0
BLAST of MC05g0204.1 vs. ExPASy TrEMBL
Match: A0A5D3CZU4 (Protein RALF-like 24 isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G002970 PE=3 SV=1) HSP 1 Score: 217 bits (552), Expect = 9.73e-71 Identity = 106/128 (82.81%), Postives = 114/128 (89.06%), Query Frame = 0
BLAST of MC05g0204.1 vs. ExPASy TrEMBL
Match: A0A0A0L7V8 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G129640 PE=3 SV=1) HSP 1 Score: 215 bits (547), Expect = 5.45e-70 Identity = 104/127 (81.89%), Postives = 114/127 (89.76%), Query Frame = 0
BLAST of MC05g0204.1 vs. TAIR 10
Match: AT3G23805.1 (ralf-like 24 ) HSP 1 Score: 115.2 bits (287), Expect = 3.9e-26 Identity = 63/118 (53.39%), Postives = 80/118 (67.80%), Query Frame = 0
BLAST of MC05g0204.1 vs. TAIR 10
Match: AT4G13950.1 (ralf-like 31 ) HSP 1 Score: 111.7 bits (278), Expect = 4.3e-25 Identity = 55/88 (62.50%), Postives = 65/88 (73.86%), Query Frame = 0
BLAST of MC05g0204.1 vs. TAIR 10
Match: AT3G05490.1 (ralf-like 22 ) HSP 1 Score: 79.7 bits (195), Expect = 1.8e-15 Identity = 49/125 (39.20%), Postives = 67/125 (53.60%), Query Frame = 0
BLAST of MC05g0204.1 vs. TAIR 10
Match: AT1G02900.1 (rapid alkalinization factor 1 ) HSP 1 Score: 76.6 bits (187), Expect = 1.5e-14 Identity = 39/73 (53.42%), Postives = 48/73 (65.75%), Query Frame = 0
BLAST of MC05g0204.1 vs. TAIR 10
Match: AT4G15800.1 (ralf-like 33 ) HSP 1 Score: 75.5 bits (184), Expect = 3.5e-14 Identity = 49/116 (42.24%), Postives = 65/116 (56.03%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|