MC01g0716.1 (mRNA) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTCATCGGCTCGAGTGAACTGGTGGCCGAACTTCGGGCGGCAGATTTCAAGAGGACCGGAGAGCGCGATTGCAGAACCAAATATGCAGATGCGAATGGCGCATTCCCAAATCTCAATGAGGAAGATTTGACATTCGTTTGCATGGACCTGGTT TTCATCGGCTCGAGTGAACTGGTGGCCGAACTTCGGGCGGCAGATTTCAAGAGGACCGGAGAGCGCGATTGCAGAACCAAATATGCAGATGCGAATGGCGCATTCCCAAATCTCAATGAGGAAGATTTGACATTCGTTTGCATGGACCTGGTT TTCATCGGCTCGAGTGAACTGGTGGCCGAACTTCGGGCGGCAGATTTCAAGAGGACCGGAGAGCGCGATTGCAGAACCAAATATGCAGATGCGAATGGCGCATTCCCAAATCTCAATGAGGAAGATTTGACATTCGTTTGCATGGACCTGGTT FIGSSELVAELRAADFKRTGERDCRTKYADANGAFPNLNEEDLTFVCMDLV Homology
BLAST of MC01g0716.1 vs. ExPASy Swiss-Prot
Match: Q6Z4P2 (Probable apyrase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=APY2 PE=2 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 9.8e-05 Identity = 16/51 (31.37%), Postives = 33/51 (64.71%), Query Frame = 0
BLAST of MC01g0716.1 vs. ExPASy Swiss-Prot
Match: Q9SPM5 (Apyrase 2 OS=Arabidopsis thaliana OX=3702 GN=APY2 PE=1 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 3.7e-04 Identity = 18/51 (35.29%), Postives = 30/51 (58.82%), Query Frame = 0
BLAST of MC01g0716.1 vs. ExPASy Swiss-Prot
Match: Q8H7L6 (Probable apyrase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=APY1 PE=3 SV=1) HSP 1 Score: 43.9 bits (102), Expect = 6.3e-04 Identity = 16/51 (31.37%), Postives = 31/51 (60.78%), Query Frame = 0
BLAST of MC01g0716.1 vs. NCBI nr
Match: XP_031262541.1 (apyrase 2-like [Pistacia vera]) HSP 1 Score: 56.2 bits (134), Expect = 2.15e-07 Identity = 24/51 (47.06%), Postives = 36/51 (70.59%), Query Frame = 0
BLAST of MC01g0716.1 vs. NCBI nr
Match: KAG5224191.1 (apyrase family protein [Salix suchowensis]) HSP 1 Score: 55.5 bits (132), Expect = 4.02e-07 Identity = 23/51 (45.10%), Postives = 35/51 (68.63%), Query Frame = 0
BLAST of MC01g0716.1 vs. NCBI nr
Match: KAF9661148.1 (hypothetical protein SADUNF_Sadunf19G0037600 [Salix dunnii]) HSP 1 Score: 55.5 bits (132), Expect = 4.02e-07 Identity = 23/51 (45.10%), Postives = 35/51 (68.63%), Query Frame = 0
BLAST of MC01g0716.1 vs. NCBI nr
Match: KAB5512113.1 (hypothetical protein DKX38_029141 [Salix brachista] >KAB5512138.1 hypothetical protein DKX38_029166 [Salix brachista]) HSP 1 Score: 55.5 bits (132), Expect = 4.02e-07 Identity = 23/51 (45.10%), Postives = 35/51 (68.63%), Query Frame = 0
BLAST of MC01g0716.1 vs. NCBI nr
Match: KAF9827073.1 (hypothetical protein H0E87_028584 [Populus deltoides]) HSP 1 Score: 54.7 bits (130), Expect = 7.51e-07 Identity = 23/49 (46.94%), Postives = 32/49 (65.31%), Query Frame = 0
BLAST of MC01g0716.1 vs. ExPASy TrEMBL
Match: A0A5N5J476 (Uncharacterized protein OS=Salix brachista OX=2182728 GN=DKX38_029141 PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 1.95e-07 Identity = 23/51 (45.10%), Postives = 35/51 (68.63%), Query Frame = 0
BLAST of MC01g0716.1 vs. ExPASy TrEMBL
Match: A0A0D6R4B1 (Uncharacterized protein OS=Araucaria cunninghamii OX=56994 PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 3.64e-07 Identity = 21/51 (41.18%), Postives = 35/51 (68.63%), Query Frame = 0
BLAST of MC01g0716.1 vs. ExPASy TrEMBL
Match: A9PEV4 (Uncharacterized protein OS=Populus trichocarpa OX=3694 PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 4.98e-07 Identity = 23/49 (46.94%), Postives = 32/49 (65.31%), Query Frame = 0
BLAST of MC01g0716.1 vs. ExPASy TrEMBL
Match: A0A2K1WNQ1 (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_019G031200 PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 4.98e-07 Identity = 23/49 (46.94%), Postives = 32/49 (65.31%), Query Frame = 0
BLAST of MC01g0716.1 vs. ExPASy TrEMBL
Match: A0A2K1WNP8 (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_019G031100 PE=3 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 6.17e-07 Identity = 22/49 (44.90%), Postives = 31/49 (63.27%), Query Frame = 0
BLAST of MC01g0716.1 vs. TAIR 10
Match: AT5G18280.1 (apyrase 2 ) HSP 1 Score: 44.7 bits (104), Expect = 2.6e-05 Identity = 18/51 (35.29%), Postives = 30/51 (58.82%), Query Frame = 0
BLAST of MC01g0716.1 vs. TAIR 10
Match: AT5G18280.2 (apyrase 2 ) HSP 1 Score: 44.7 bits (104), Expect = 2.6e-05 Identity = 18/51 (35.29%), Postives = 30/51 (58.82%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|