Sequences
The following sequences are available for this feature:
Legend: exon CDS polypeptide
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGGGAAGACGAAATCTTGGAAGGCGACTTCATTGCGAGAGAAGGCTCAGCAGAAACACGACAGAGGATTTGATTTTCGCGAACAAGGAGGACGAAGAGAAGGTTCGTGCGAGAGATTTAGGGTGATGGCGAACAAGGAAGACGAAGAGGATTTGATTTTTGTGAACAAGGAGGACAAACAGAAGGTTCGTGCGAGAGATTTAGGGTGA
ATGGGGAAGACGAAATCTTGGAAGGCGACTTCATTGCGAGAGAAGGCTCAGCAGAAACACGACAGAGGATTTGATTTTCGCGAACAAGGAGGACGAAGAGAAGGTTCGTGCGAGAGATTTAGGGTGATGGCGAACAAGGAAGACGAAGAGGATTTGATTTTTGTGAACAAGGAGGACAAACAGAAGGTTCGTGCGAGAGATTTAGGGTGA
ATGGGGAAGACGAAATCTTGGAAGGCGACTTCATTGCGAGAGAAGGCTCAGCAGAAACACGACAGAGGATTTGATTTTCGCGAACAAGGAGGACGAAGAGAAGGTTCGTGCGAGAGATTTAGGGTGATGGCGAACAAGGAAGACGAAGAGGATTTGATTTTTGTGAACAAGGAGGACAAACAGAAGGTTCGTGCGAGAGATTTAGGGTGA
MGKTKSWKATSLREKAQQKHDRGFDFREQGGRREGSCERFRVMANKEDEEDLIFVNKEDKQKVRARDLG
Homology
BLAST of IVF0025017.1 vs. ExPASy TrEMBL
Match:
A0A5D3C784 (Integrase catalytic domain-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1737G00660 PE=4 SV=1)
HSP 1 Score: 77.8 bits (190), Expect = 2.0e-11
Identity = 42/55 (76.36%), Postives = 45/55 (81.82%), Query Frame = 0
BLAST of IVF0025017.1 vs. NCBI nr
Match:
KAA0050651.1 (uncharacterized protein E6C27_scaffold673G001250 [Cucumis melo var. makuwa] >TYK07783.1 uncharacterized protein E5676_scaffold1737G00660 [Cucumis melo var. makuwa])
HSP 1 Score: 77.0 bits (188), Expect = 7.57e-15
Identity = 39/43 (90.70%), Postives = 40/43 (93.02%), Query Frame = 0
The following BLAST results are available for this feature:
Match Name E-value Identity Description
Match Name E-value Identity Description
A0A5D3C784 2.0e-11 76.36 Integrase catalytic domain-containing protein OS=Cucumis melo var. makuwa OX=119... [more]
Match Name E-value Identity Description
KAA0050651.1 7.57e-15 90.70 uncharacterized protein E6C27_scaffold673G001250 [Cucumis melo var. makuwa] >TYK... [more]
Match Name E-value Identity Description
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
A T G G G G A A G A C G A A A T C T T G G A A G G C G A C T T C A T T G C G A G A G A A G G C T C A G C A G A A A C A C G A C A G A G G A T T T G A T T T T C G C G A A C A A G G A G G A C G A A G A G A A G G T T C G T G C G A G A G A T T T A G G G T G A T G G C G A A C A A G G A A G A C G A A G A G G A T T T G A T T T T T G T G A A C A A G G A G G A C A A A C A G A A G G T T C G T G C G A G A G A T T T A G G G T G A 20 40 60 80 100 120 140 160 180 200 Score = Score = Sequence mobidb-lite mobidb-lite
IPR Term IPR Description Source Source Term Source Description Alignment
None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 8..38 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 1..38
Relationships
This mRNA is a part of the following gene feature(s):
Feature Name Unique Name Type
IVF0025017 IVF0025017 gene
The following exon feature(s) are a part of this mRNA:
Feature Name Unique Name Type
IVF0025017.1-exon IVF0025017.1-exon-chr05:17694707..17694916 exon
The following CDS feature(s) are a part of this mRNA:
Feature Name Unique Name Type
IVF0025017.1-cds IVF0025017.1-cds-chr05:17694707..17694916 CDS
The following polypeptide feature(s) derives from this mRNA:
Feature Name Unique Name Type
IVF0025017.1 IVF0025017.1-protein polypeptide
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
Category
Term Accession
Term Name
biological_process
GO:0015074 DNA integration
molecular_function
GO:0003676 nucleic acid binding
