
IVF0006010.1 (mRNA) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAGGATGATGAGGAGATAAAAGTGGAATGCCATATGTTAGAGGAGAACTCATACTGCAGTGGAGCTTCATTTGTTCCCAGAGAAAATGGAGAGGAAGAAGATGATGGTTGGATAATTGCTCATGTTCACAATGAGATTACTAATACTTCTCAGGTTAATTATTAATTATCATTCCATTCATTATATAACTATTAATTATCTTACTAATCATATATATATATATTATTCTATATTCTCTAATTAGCTTAATTTAATTGTGATTTTAATCAACAGGTATATGTATTAGATGCAAGAAAATTCAGTGAGGAGCCAATTGCAAAAATCACACTTCCACAAAGAGTTCCTTATGGATTCCATGGTGCTTTCATGCCCATCAAAAATAATTAA ATGCAGGATGATGAGGAGATAAAAGTGGAATGCCATATGTTAGAGGAGAACTCATACTGCAGTGGAGCTTCATTTGTTCCCAGAGAAAATGGAGAGGAAGAAGATGATGGTTGGATAATTGCTCATGTTCACAATGAGATTACTAATACTTCTCAGGTATATGTATTAGATGCAAGAAAATTCAGTGAGGAGCCAATTGCAAAAATCACACTTCCACAAAGAGTTCCTTATGGATTCCATGGTGCTTTCATGCCCATCAAAAATAATTAA ATGCAGGATGATGAGGAGATAAAAGTGGAATGCCATATGTTAGAGGAGAACTCATACTGCAGTGGAGCTTCATTTGTTCCCAGAGAAAATGGAGAGGAAGAAGATGATGGTTGGATAATTGCTCATGTTCACAATGAGATTACTAATACTTCTCAGGTATATGTATTAGATGCAAGAAAATTCAGTGAGGAGCCAATTGCAAAAATCACACTTCCACAAAGAGTTCCTTATGGATTCCATGGTGCTTTCATGCCCATCAAAAATAATTAA MQDDEEIKVECHMLEENSYCSGASFVPRENGEEEDDGWIIAHVHNEITNTSQVYVLDARKFSEEPIAKITLPQRVPYGFHGAFMPIKNN Homology
BLAST of IVF0006010.1 vs. ExPASy Swiss-Prot
Match: Q84KG5 (Carotenoid 9,10(9',10')-cleavage dioxygenase OS=Crocus sativus OX=82528 GN=CCD PE=1 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 6.9e-14 Identity = 38/68 (55.88%), Postives = 47/68 (69.12%), Query Frame = 0
BLAST of IVF0006010.1 vs. ExPASy Swiss-Prot
Match: O65572 (Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Arabidopsis thaliana OX=3702 GN=CCD1 PE=1 SV=2) HSP 1 Score: 75.1 bits (183), Expect = 4.5e-13 Identity = 38/71 (53.52%), Postives = 47/71 (66.20%), Query Frame = 0
BLAST of IVF0006010.1 vs. ExPASy Swiss-Prot
Match: C3VEQ4 (Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Oncidium hybrid cultivar OX=141207 GN=CCD1 PE=2 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 4.5e-13 Identity = 37/66 (56.06%), Postives = 47/66 (71.21%), Query Frame = 0
BLAST of IVF0006010.1 vs. ExPASy Swiss-Prot
Match: Q8LP17 (Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Pisum sativum OX=3888 GN=CCD1 PE=2 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.0e-12 Identity = 36/66 (54.55%), Postives = 47/66 (71.21%), Query Frame = 0
BLAST of IVF0006010.1 vs. ExPASy Swiss-Prot
Match: O49675 (Probable carotenoid cleavage dioxygenase 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CCD4 PE=1 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 3.2e-11 Identity = 34/85 (40.00%), Postives = 50/85 (58.82%), Query Frame = 0
BLAST of IVF0006010.1 vs. ExPASy TrEMBL
Match: A0A1S3CQD3 (carotenoid 9,10(9',10')-cleavage dioxygenase 1-like isoform X3 OS=Cucumis melo OX=3656 GN=LOC103503600 PE=3 SV=1) HSP 1 Score: 186.4 bits (472), Expect = 5.1e-44 Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of IVF0006010.1 vs. ExPASy TrEMBL
Match: A0A5D3E541 (Carotenoid 9,10(9',10')-cleavage dioxygenase 1-like isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold455G005030 PE=3 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 3.2e-38 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of IVF0006010.1 vs. ExPASy TrEMBL
Match: A0A5A7T6Y7 (Carotenoid 9,10(9',10')-cleavage dioxygenase 1-like isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold92G001480 PE=3 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 3.2e-38 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of IVF0006010.1 vs. ExPASy TrEMBL
Match: A0A1S3CRS3 (carotenoid 9,10(9',10')-cleavage dioxygenase 1-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103503600 PE=3 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 3.2e-38 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of IVF0006010.1 vs. ExPASy TrEMBL
Match: A0A0A0LH17 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G895700 PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 6.0e-37 Identity = 77/83 (92.77%), Postives = 81/83 (97.59%), Query Frame = 0
BLAST of IVF0006010.1 vs. NCBI nr
Match: XP_008466060.1 (PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like isoform X3 [Cucumis melo]) HSP 1 Score: 182 bits (463), Expect = 2.28e-52 Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of IVF0006010.1 vs. NCBI nr
Match: KAE8651415.1 (hypothetical protein Csa_002093 [Cucumis sativus]) HSP 1 Score: 164 bits (415), Expect = 1.03e-50 Identity = 77/82 (93.90%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of IVF0006010.1 vs. NCBI nr
Match: TYK31217.1 (carotenoid 9,10(9',10')-cleavage dioxygenase 1-like isoform X1 [Cucumis melo var. makuwa]) HSP 1 Score: 164 bits (414), Expect = 1.67e-45 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of IVF0006010.1 vs. NCBI nr
Match: KAA0038618.1 (carotenoid 9,10(9',10')-cleavage dioxygenase 1-like isoform X1 [Cucumis melo var. makuwa]) HSP 1 Score: 164 bits (414), Expect = 1.87e-45 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of IVF0006010.1 vs. NCBI nr
Match: XP_031737601.1 (carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Cucumis sativus]) HSP 1 Score: 164 bits (415), Expect = 2.14e-45 Identity = 77/82 (93.90%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of IVF0006010.1 vs. TAIR 10
Match: AT3G63520.1 (carotenoid cleavage dioxygenase 1 ) HSP 1 Score: 75.1 bits (183), Expect = 3.2e-14 Identity = 38/71 (53.52%), Postives = 47/71 (66.20%), Query Frame = 0
BLAST of IVF0006010.1 vs. TAIR 10
Match: AT4G19170.1 (nine-cis-epoxycarotenoid dioxygenase 4 ) HSP 1 Score: 68.9 bits (167), Expect = 2.3e-12 Identity = 34/85 (40.00%), Postives = 50/85 (58.82%), Query Frame = 0
BLAST of IVF0006010.1 vs. TAIR 10
Match: AT3G14440.1 (nine-cis-epoxycarotenoid dioxygenase 3 ) HSP 1 Score: 62.4 bits (150), Expect = 2.1e-10 Identity = 33/77 (42.86%), Postives = 49/77 (63.64%), Query Frame = 0
BLAST of IVF0006010.1 vs. TAIR 10
Match: AT4G18350.1 (nine-cis-epoxycarotenoid dioxygenase 2 ) HSP 1 Score: 62.4 bits (150), Expect = 2.1e-10 Identity = 31/63 (49.21%), Postives = 41/63 (65.08%), Query Frame = 0
BLAST of IVF0006010.1 vs. TAIR 10
Match: AT1G30100.1 (nine-cis-epoxycarotenoid dioxygenase 5 ) HSP 1 Score: 54.3 bits (129), Expect = 5.8e-08 Identity = 29/78 (37.18%), Postives = 46/78 (58.97%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|