
IVF0004138.2 (mRNA) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTCCTGATTTATCTGTTTCTTCATCTCTGTAATCTACATTCAGGTAAGGTTCATGGATCTTCAGCTCGTGCCGATAAGGTGAGAGGCCAGACACCAAAGGTTGCTAAACAAGACAAGAAGAAGAAGCCACGAGGACATGCTCACAAACGGATGCAATACAACCGTAGATTCGTAACTGCCGGTATGTGTTTATTCTCGCAATTTTCTCTCCCTCTCTCTGATATTATATTCATGTTTCTTGTTTTTTTTTTTATGAATTTTAATTTCCGCTTGTAGTTGTTGGTTTCAGCAAGAAGAGAGGACCAAAGTCGTTCGAGAAGTAA ATGTTCCTGATTTATCTGTTTCTTCATCTCTGTAATCTACATTCAGGTAAGGTTCATGGATCTTCAGCTCGTGCCGATAAGGTGAGAGGCCAGACACCAAAGGTTGCTAAACAAGACAAGAAGAAGAAGCCACGAGGACATGCTCACAAACGGATGCAATACAACCGTAGATTCGTAACTGCCGTTGTTGGTTTCAGCAAGAAGAGAGGACCAAAGTCGTTCGAGAAGTAA ATGTTCCTGATTTATCTGTTTCTTCATCTCTGTAATCTACATTCAGGTAAGGTTCATGGATCTTCAGCTCGTGCCGATAAGGTGAGAGGCCAGACACCAAAGGTTGCTAAACAAGACAAGAAGAAGAAGCCACGAGGACATGCTCACAAACGGATGCAATACAACCGTAGATTCGTAACTGCCGTTGTTGGTTTCAGCAAGAAGAGAGGACCAAAGTCGTTCGAGAAGTAA MFLIYLFLHLCNLHSGKVHGSSARADKVRGQTPKVAKQDKKKKPRGHAHKRMQYNRRFVTAVVGFSKKRGPKSFEK Homology
BLAST of IVF0004138.2 vs. ExPASy Swiss-Prot
Match: P49689 (40S ribosomal protein S30 OS=Arabidopsis thaliana OX=3702 GN=RPS30A PE=3 SV=3) HSP 1 Score: 105.5 bits (262), Expect = 2.6e-22 Identity = 53/61 (86.89%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of IVF0004138.2 vs. ExPASy Swiss-Prot
Match: P62866 (40S ribosomal protein S30 OS=Bos taurus OX=9913 GN=FAU PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 9.1e-15 Identity = 41/57 (71.93%), Postives = 45/57 (78.95%), Query Frame = 0
BLAST of IVF0004138.2 vs. ExPASy Swiss-Prot
Match: P62860 (40S ribosomal protein S30 OS=Cricetulus griseus OX=10029 GN=FAU PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 9.1e-15 Identity = 41/57 (71.93%), Postives = 45/57 (78.95%), Query Frame = 0
BLAST of IVF0004138.2 vs. ExPASy Swiss-Prot
Match: P62861 (40S ribosomal protein S30 OS=Homo sapiens OX=9606 GN=FAU PE=1 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 9.1e-15 Identity = 41/57 (71.93%), Postives = 45/57 (78.95%), Query Frame = 0
BLAST of IVF0004138.2 vs. ExPASy Swiss-Prot
Match: P62862 (40S ribosomal protein S30 OS=Mus musculus OX=10090 GN=Fau PE=1 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 9.1e-15 Identity = 41/57 (71.93%), Postives = 45/57 (78.95%), Query Frame = 0
BLAST of IVF0004138.2 vs. ExPASy TrEMBL
Match: A0A5A7SNT1 (40S ribosomal protein S30 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold701G00200 PE=3 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 4.5e-25 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of IVF0004138.2 vs. ExPASy TrEMBL
Match: A0A1S3BVA2 (40S ribosomal protein S30 OS=Cucumis melo OX=3656 GN=LOC103493880 PE=3 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 4.5e-25 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of IVF0004138.2 vs. ExPASy TrEMBL
Match: A0A444F7Y5 (40S ribosomal protein S30 OS=Ensete ventricosum OX=4639 GN=GW17_00017242 PE=3 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 1.0e-21 Identity = 60/76 (78.95%), Postives = 63/76 (82.89%), Query Frame = 0
BLAST of IVF0004138.2 vs. ExPASy TrEMBL
Match: A0A5N5NRR1 (Uncharacterized protein OS=Salix brachista OX=2182728 GN=DKX38_003471 PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 1.8e-21 Identity = 57/64 (89.06%), Postives = 57/64 (89.06%), Query Frame = 0
BLAST of IVF0004138.2 vs. ExPASy TrEMBL
Match: K3Y2S3 (40S ribosomal protein S30 OS=Setaria italica OX=4555 PE=3 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 2.3e-21 Identity = 56/65 (86.15%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of IVF0004138.2 vs. NCBI nr
Match: XP_008453058.1 (PREDICTED: 40S ribosomal protein S30-like [Cucumis melo]) HSP 1 Score: 122 bits (305), Expect = 1.65e-34 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of IVF0004138.2 vs. NCBI nr
Match: KAA0032460.1 (40S ribosomal protein S30-like [Cucumis melo var. makuwa] >TYJ99905.1 40S ribosomal protein S30-like [Cucumis melo var. makuwa]) HSP 1 Score: 122 bits (305), Expect = 2.36e-34 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of IVF0004138.2 vs. NCBI nr
Match: RZR96505.1 (hypothetical protein BHM03_00025534, partial [Ensete ventricosum]) HSP 1 Score: 111 bits (278), Expect = 5.03e-30 Identity = 60/76 (78.95%), Postives = 63/76 (82.89%), Query Frame = 0
BLAST of IVF0004138.2 vs. NCBI nr
Match: XP_038692446.1 (40S ribosomal protein S30-like [Tripterygium wilfordii]) HSP 1 Score: 110 bits (275), Expect = 6.25e-30 Identity = 56/61 (91.80%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of IVF0004138.2 vs. NCBI nr
Match: RWW18752.1 (hypothetical protein GW17_00017242 [Ensete ventricosum] >RWW68159.1 hypothetical protein BHE74_00024358 [Ensete ventricosum]) HSP 1 Score: 111 bits (278), Expect = 7.12e-30 Identity = 60/76 (78.95%), Postives = 63/76 (82.89%), Query Frame = 0
BLAST of IVF0004138.2 vs. TAIR 10
Match: AT2G19750.1 (Ribosomal protein S30 family protein ) HSP 1 Score: 105.5 bits (262), Expect = 1.9e-23 Identity = 53/61 (86.89%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of IVF0004138.2 vs. TAIR 10
Match: AT4G29390.1 (Ribosomal protein S30 family protein ) HSP 1 Score: 105.5 bits (262), Expect = 1.9e-23 Identity = 53/61 (86.89%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of IVF0004138.2 vs. TAIR 10
Match: AT5G56670.1 (Ribosomal protein S30 family protein ) HSP 1 Score: 105.5 bits (262), Expect = 1.9e-23 Identity = 53/61 (86.89%), Postives = 55/61 (90.16%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|