Csor.00g296050.m01 (mRNA) Silver-seed gourd (wild; sororia) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSsinglepolypeptidestart_codonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTAGATGGTGGTCTGTCATGGGCAGATCAATGGGATTCCAACCCTGACCCAGGCCCTCCACCATCGTCGGCAGAAAACGGGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGGAGAAGGAGGATGGGGGATCCTCCTCGTCAGAGAAGAGCATATTTAAGAAGGCAAGCTTGAAGTGGATAAAGGAATTGCGAAAGAAATCTGAGAAATCTTGA ATGGGTTTAGATGGTGGTCTGTCATGGGCAGATCAATGGGATTCCAACCCTGACCCAGGCCCTCCACCATCGTCGGCAGAAAACGGGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGGAGAAGGAGGATGGGGGATCCTCCTCGTCAGAGAAGAGCATATTTAAGAAGGCAAGCTTGAAGTGGATAAAGGAATTGCGAAAGAAATCTGAGAAATCTTGA ATGGGTTTAGATGGTGGTCTGTCATGGGCAGATCAATGGGATTCCAACCCTGACCCAGGCCCTCCACCATCGTCGGCAGAAAACGGGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGGAGAAGGAGGATGGGGGATCCTCCTCGTCAGAGAAGAGCATATTTAAGAAGGCAAGCTTGAAGTGGATAAAGGAATTGCGAAAGAAATCTGAGAAATCTTGA MGLDGGLSWADQWDSNPDPGPPPSSAENGKKKKKKKKKKEKEDGGSSSSEKSIFKKASLKWIKELRKKSEKS Homology
BLAST of Csor.00g296050.m01 vs. NCBI nr
Match: KAG6583660.1 (hypothetical protein SDJN03_19592, partial [Cucurbita argyrosperma subsp. sororia] >KAG7032466.1 hypothetical protein SDJN02_06514, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 130 bits (328), Expect = 5.67e-38 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of Csor.00g296050.m01 vs. NCBI nr
Match: XP_022932206.1 (uncharacterized protein LOC111438527 [Cucurbita moschata] >XP_023519855.1 uncharacterized protein LOC111783185 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 122 bits (305), Expect = 1.74e-34 Identity = 69/72 (95.83%), Postives = 70/72 (97.22%), Query Frame = 0
BLAST of Csor.00g296050.m01 vs. NCBI nr
Match: XP_022970362.1 (uncharacterized protein LOC111469348 [Cucurbita maxima]) HSP 1 Score: 115 bits (288), Expect = 6.29e-32 Identity = 65/72 (90.28%), Postives = 66/72 (91.67%), Query Frame = 0
BLAST of Csor.00g296050.m01 vs. NCBI nr
Match: KAG7012753.1 (Mitotic spindle checkpoint protein MAD2 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 100 bits (249), Expect = 1.01e-23 Identity = 61/71 (85.92%), Postives = 65/71 (91.55%), Query Frame = 0
BLAST of Csor.00g296050.m01 vs. NCBI nr
Match: XP_038892905.1 (uncharacterized protein LOC120081808 [Benincasa hispida]) HSP 1 Score: 69.7 bits (169), Expect = 7.78e-14 Identity = 48/74 (64.86%), Postives = 53/74 (71.62%), Query Frame = 0
BLAST of Csor.00g296050.m01 vs. ExPASy TrEMBL
Match: A0A6J1EVQ9 (uncharacterized protein LOC111438527 OS=Cucurbita moschata OX=3662 GN=LOC111438527 PE=4 SV=1) HSP 1 Score: 122 bits (305), Expect = 8.41e-35 Identity = 69/72 (95.83%), Postives = 70/72 (97.22%), Query Frame = 0
BLAST of Csor.00g296050.m01 vs. ExPASy TrEMBL
Match: A0A6J1HYV9 (uncharacterized protein LOC111469348 OS=Cucurbita maxima OX=3661 GN=LOC111469348 PE=4 SV=1) HSP 1 Score: 115 bits (288), Expect = 3.04e-32 Identity = 65/72 (90.28%), Postives = 66/72 (91.67%), Query Frame = 0
BLAST of Csor.00g296050.m01 vs. ExPASy TrEMBL
Match: A0A0A0KVC1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G590180 PE=4 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 5.22e-14 Identity = 48/74 (64.86%), Postives = 53/74 (71.62%), Query Frame = 0
BLAST of Csor.00g296050.m01 vs. ExPASy TrEMBL
Match: A0A1S3BE81 (uncharacterized protein LOC103488917 OS=Cucumis melo OX=3656 GN=LOC103488917 PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 3.01e-13 Identity = 46/74 (62.16%), Postives = 53/74 (71.62%), Query Frame = 0
BLAST of Csor.00g296050.m01 vs. ExPASy TrEMBL
Match: A0A314ZLJ7 (Uncharacterized protein OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_33641 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.66e-10 Identity = 39/69 (56.52%), Postives = 46/69 (66.67%), Query Frame = 0
BLAST of Csor.00g296050.m01 vs. TAIR 10
Match: AT1G67670.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G24405.1); Has 18 Blast hits to 18 proteins in 6 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 18; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 58.5 bits (140), Expect = 2.5e-09 Identity = 40/69 (57.97%), Postives = 47/69 (68.12%), Query Frame = 0
BLAST of Csor.00g296050.m01 vs. TAIR 10
Match: AT1G24405.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G67670.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 55.5 bits (132), Expect = 2.1e-08 Identity = 41/69 (59.42%), Postives = 46/69 (66.67%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (sororia) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following single feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|