
CsaV3_7G020970.1 (mRNA) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGATTGCAATGCCACAAAATACCCGATGGAACCCAAGGCACAACTTCACAAAGACACGGAAGAAGCACCAATTGATGCTACGGAGTACAGAAGCATCGTCGTTGTTGTCTTAGACTACTTACTGAACACAAGGCCAGATCTTTCATATGTTGTTGGGATGGCGAGTAGGTATATGGAAAGGCCTACAACCATGCATTACAAGGTGGTCAAGCAAATACTTAG ATGGCTGATTGCAATGCCACAAAATACCCGATGGAACCCAAGGCACAACTTCACAAAGACACGGAAGAAGCACCAATTGATGCTACGGAGTACAGAAGCATCGTCGTTGTTGTCTTAGACTACTTACTGAACACAAGGCCAGATCTTTCATATGTTGTTGGGATGGCGAGTAGGTATATGGAAAGGCCTACAACCATGCATTACAAGGTGGTCAAGCAAATACTTAG ATGGCTGATTGCAATGCCACAAAATACCCGATGGAACCCAAGGCACAACTTCACAAAGACACGGAAGAAGCACCAATTGATGCTACGGAGTACAGAAGCATCGTCGTTGTTGTCTTAGACTACTTACTGAACACAAGGCCAGATCTTTCATATGTTGTTGGGATGGCGAGTAGGTATATGGAAAGGCCTACAACCATGCATTACAAGGTGGTCAAGCAAATACTTAG MADCNATKYPMEPKAQLHKDTEEAPIDATEYRSIVVVVLDYLLNTRPDLSYVVGMASRYMERPTTMHYKVVKQILX Homology
BLAST of CsaV3_7G020970.1 vs. NCBI nr
Match: KGN44333.2 (hypothetical protein Csa_016167, partial [Cucumis sativus]) HSP 1 Score: 153.3 bits (386), Expect = 8.4e-34 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 0
BLAST of CsaV3_7G020970.1 vs. NCBI nr
Match: XP_031745072.1 (secreted RxLR effector protein 161-like [Cucumis sativus]) HSP 1 Score: 153.3 bits (386), Expect = 8.4e-34 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 0
BLAST of CsaV3_7G020970.1 vs. NCBI nr
Match: KAE8648201.1 (hypothetical protein Csa_018467, partial [Cucumis sativus]) HSP 1 Score: 137.1 bits (344), Expect = 6.3e-29 Identity = 70/75 (93.33%), Postives = 70/75 (93.33%), Query Frame = 0
BLAST of CsaV3_7G020970.1 vs. NCBI nr
Match: KAE8646020.1 (hypothetical protein Csa_015698 [Cucumis sativus]) HSP 1 Score: 135.6 bits (340), Expect = 1.8e-28 Identity = 69/75 (92.00%), Postives = 69/75 (92.00%), Query Frame = 0
BLAST of CsaV3_7G020970.1 vs. NCBI nr
Match: KAE8652919.1 (hypothetical protein Csa_004527, partial [Cucumis sativus]) HSP 1 Score: 135.6 bits (340), Expect = 1.8e-28 Identity = 69/75 (92.00%), Postives = 69/75 (92.00%), Query Frame = 0
BLAST of CsaV3_7G020970.1 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 7.0e-07 Identity = 33/70 (47.14%), Postives = 39/70 (55.71%), Query Frame = 0
BLAST of CsaV3_7G020970.1 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.7e-05 Identity = 29/66 (43.94%), Postives = 37/66 (56.06%), Query Frame = 0
BLAST of CsaV3_7G020970.1 vs. ExPASy Swiss-Prot
Match: P92519 (Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana OX=3702 GN=AtMg00810 PE=4 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 1.5e-04 Identity = 27/75 (36.00%), Postives = 40/75 (53.33%), Query Frame = 0
BLAST of CsaV3_7G020970.1 vs. ExPASy TrEMBL
Match: A0A5K0VEQ6 (Reverse transcriptase Ty1/copia-type domain-containing protein (Fragment) OS=Nymphaea colorata OX=210225 GN=NYM_LOCUS1129 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 2.4e-18 Identity = 49/75 (65.33%), Postives = 59/75 (78.67%), Query Frame = 0
BLAST of CsaV3_7G020970.1 vs. ExPASy TrEMBL
Match: A0A0A9FJ50 (Reverse transcriptase Ty1/copia-type domain-containing protein OS=Arundo donax OX=35708 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 2.4e-18 Identity = 51/75 (68.00%), Postives = 61/75 (81.33%), Query Frame = 0
BLAST of CsaV3_7G020970.1 vs. ExPASy TrEMBL
Match: Q0J8A6 (Os08g0125300 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0125300 PE=2 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 7.0e-18 Identity = 50/75 (66.67%), Postives = 57/75 (76.00%), Query Frame = 0
BLAST of CsaV3_7G020970.1 vs. ExPASy TrEMBL
Match: B8BDZ6 (Uncharacterized protein OS=Oryza sativa subsp. indica OX=39946 GN=OsI_30754 PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 7.0e-18 Identity = 50/75 (66.67%), Postives = 57/75 (76.00%), Query Frame = 0
BLAST of CsaV3_7G020970.1 vs. ExPASy TrEMBL
Match: A0A0P0XB91 (Os08g0125300 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0125300 PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 7.0e-18 Identity = 50/75 (66.67%), Postives = 57/75 (76.00%), Query Frame = 0
BLAST of CsaV3_7G020970.1 vs. TAIR 10
Match: ATMG00810.1 (DNA/RNA polymerases superfamily protein ) HSP 1 Score: 46.6 bits (109), Expect = 1.0e-05 Identity = 27/75 (36.00%), Postives = 40/75 (53.33%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|