![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CsaV3_6G006620.1 (mRNA) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATCAGACCACAGATTCCTAGCTTGTTCATGGGATGGTGTGGAGTGTGATGACAAAAGAGAAGGCCATGTTGTTGGTCTTCATCTTGGCTGCAGTTTTCTCAATGCAAGTACTCTTCATCCCAACAACACCCTTTTCACCCTCTCCCACCTCAAAACCTTGAATCTTTCTTACAATCATTTGGCAGGATCTCCATTTTCACCTCAATTCGGAATGCTTTCAAACTTGAGAGTTTCTGGATCTTTCGGGGTCATCTTTCAAAGGTCATGTTCCATTACAAATTTCACATTTGTTTAA ATGGAATCAGACCACAGATTCCTAGCTTGTTCATGGGATGGTGTGGAGTGTGATGACAAAAGAGAAGGCCATGTTGTTGGTCTTCATCTTGGCTGCAGTTTTCTCAATGCAAGTACTCTTCATCCCAACAACACCCTTTTCACCCTCTCCCACCTCAAAACCTTGAATCTTTCTTACAATCATTTGGCAGGATCTCCATTTTCACCTCAATTCGGAATGCTTTCAAACTTGAGAGTTTCTGGATCTTTCGGGGTCATCTTTCAAAGGTCATGTTCCATTACAAATTTCACATTTGTTTAA ATGGAATCAGACCACAGATTCCTAGCTTGTTCATGGGATGGTGTGGAGTGTGATGACAAAAGAGAAGGCCATGTTGTTGGTCTTCATCTTGGCTGCAGTTTTCTCAATGCAAGTACTCTTCATCCCAACAACACCCTTTTCACCCTCTCCCACCTCAAAACCTTGAATCTTTCTTACAATCATTTGGCAGGATCTCCATTTTCACCTCAATTCGGAATGCTTTCAAACTTGAGAGTTTCTGGATCTTTCGGGGTCATCTTTCAAAGGTCATGTTCCATTACAAATTTCACATTTGTTTAA MESDHRFLACSWDGVECDDKREGHVVGLHLGCSFLNASTLHPNNTLFTLSHLKTLNLSYNHLAGSPFSPQFGMLSNLRVSGSFGVIFQRSCSITNFTFV* Homology
BLAST of CsaV3_6G006620.1 vs. NCBI nr
Match: KAE8646711.1 (hypothetical protein Csa_005021 [Cucumis sativus]) HSP 1 Score: 209.9 bits (533), Expect = 1.0e-50 Identity = 99/99 (100.00%), Postives = 99/99 (100.00%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. NCBI nr
Match: XP_016902475.1 (PREDICTED: receptor like protein 30-like [Cucumis melo]) HSP 1 Score: 125.6 bits (314), Expect = 2.5e-25 Identity = 60/79 (75.95%), Postives = 66/79 (83.54%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. NCBI nr
Match: XP_008460051.1 (PREDICTED: receptor like protein 30-like [Cucumis melo]) HSP 1 Score: 122.1 bits (305), Expect = 2.7e-24 Identity = 56/70 (80.00%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. NCBI nr
Match: XP_004153416.3 (receptor-like protein 6 [Cucumis sativus] >KAE8646715.1 hypothetical protein Csa_005309 [Cucumis sativus]) HSP 1 Score: 121.7 bits (304), Expect = 3.6e-24 Identity = 56/70 (80.00%), Postives = 63/70 (90.00%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. NCBI nr
Match: KAA0039945.1 (receptor-like protein 12 [Cucumis melo var. makuwa]) HSP 1 Score: 117.1 bits (292), Expect = 8.8e-23 Identity = 55/70 (78.57%), Postives = 61/70 (87.14%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. ExPASy Swiss-Prot
Match: Q40235 (Receptor-like protein Cf-9 OS=Solanum pimpinellifolium OX=4084 GN=CF-9 PE=1 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 3.6e-11 Identity = 36/68 (52.94%), Postives = 45/68 (66.18%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. ExPASy Swiss-Prot
Match: O49879 (Receptor-like protein Cf-9 homolog OS=Solanum lycopersicum OX=4081 GN=HCR9-0 PE=2 SV=2) HSP 1 Score: 65.5 bits (158), Expect = 4.0e-10 Identity = 35/68 (51.47%), Postives = 44/68 (64.71%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. ExPASy Swiss-Prot
Match: P0DO05 (Receptor-like protein 9DC1 OS=Solanum pimpinellifolium OX=4084 GN=9DC1 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 6.8e-10 Identity = 35/68 (51.47%), Postives = 44/68 (64.71%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. ExPASy Swiss-Prot
Match: P0DO06 (Receptor-like protein 9DC2 OS=Solanum pimpinellifolium OX=4084 GN=9DC2 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 6.8e-10 Identity = 35/68 (51.47%), Postives = 44/68 (64.71%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. ExPASy Swiss-Prot
Match: Q5MR23 (Receptor-like protein 9DC3 OS=Solanum pimpinellifolium OX=4084 GN=9DC3 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 6.8e-10 Identity = 35/68 (51.47%), Postives = 44/68 (64.71%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. ExPASy TrEMBL
Match: A0A0A0KD19 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G080300 PE=4 SV=1) HSP 1 Score: 187.6 bits (475), Expect = 2.6e-44 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. ExPASy TrEMBL
Match: A0A1S4E3C1 (receptor like protein 30-like OS=Cucumis melo OX=3656 GN=LOC103498984 PE=4 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 1.2e-25 Identity = 60/79 (75.95%), Postives = 66/79 (83.54%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. ExPASy TrEMBL
Match: A0A1S3CC35 (receptor like protein 30-like OS=Cucumis melo OX=3656 GN=LOC103498983 PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 1.3e-24 Identity = 56/70 (80.00%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. ExPASy TrEMBL
Match: A0A0A0K946 (LRRNT_2 domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G080330 PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 1.7e-24 Identity = 56/70 (80.00%), Postives = 63/70 (90.00%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. ExPASy TrEMBL
Match: A0A5D3DLU2 (Receptor like protein 30-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold266G001030 PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 4.3e-23 Identity = 55/70 (78.57%), Postives = 61/70 (87.14%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. TAIR 10
Match: AT1G45616.1 (receptor like protein 6 ) HSP 1 Score: 63.2 bits (152), Expect = 1.4e-10 Identity = 31/68 (45.59%), Postives = 41/68 (60.29%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. TAIR 10
Match: AT1G47890.1 (receptor like protein 7 ) HSP 1 Score: 57.8 bits (138), Expect = 5.9e-09 Identity = 31/68 (45.59%), Postives = 41/68 (60.29%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. TAIR 10
Match: AT3G24982.1 (receptor like protein 40 ) HSP 1 Score: 53.9 bits (128), Expect = 8.5e-08 Identity = 35/90 (38.89%), Postives = 49/90 (54.44%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. TAIR 10
Match: AT3G25020.1 (receptor like protein 42 ) HSP 1 Score: 52.0 bits (123), Expect = 3.2e-07 Identity = 34/90 (37.78%), Postives = 49/90 (54.44%), Query Frame = 0
BLAST of CsaV3_6G006620.1 vs. TAIR 10
Match: AT3G11080.1 (receptor like protein 35 ) HSP 1 Score: 51.2 bits (121), Expect = 5.5e-07 Identity = 29/68 (42.65%), Postives = 41/68 (60.29%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|