
CsGy4G007530.1 (mRNA) Cucumber (Gy14) v2.1
Overview
Sequences
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GAAAATTAAAGAAAGAAAAATAAATATTCTGCATAAAAGAAGTTCTCAGTTTCCCAAATGGAAGCACCTCATTCAACTAGGGTTGTGATTATTGACACCAAGTACGTGCAAACGGATGCCAAGAGCTTCAAGACAGTGGTGCAAAAGCTGACAGGCAAAGATTCGGTGGTGACAGTGGCTGAGGAAACCCGACGACAAACTGGTAGTGCCCGAAACTCGAGTCTTTTGAGAGATTCATCGTTCAAAGAGTTTCAAAGGGTGCTGAGAGAGATGCCAAGAATTGATGAGCTTTATTCTGATTGAAATGAATAGTAC GAAAATTAAAGAAAGAAAAATAAATATTCTGCATAAAAGAAGTTCTCAGTTTCCCAAATGGAAGCACCTCATTCAACTAGGGTTGTGATTATTGACACCAAGTACGTGCAAACGGATGCCAAGAGCTTCAAGACAGTGGTGCAAAAGCTGACAGGCAAAGATTCGGTGGTGACAGTGGCTGAGGAAACCCGACGACAAACTGGTAGTGCCCGAAACTCGAGTCTTTTGAGAGATTCATCGTTCAAAGAGTTTCAAAGGGTGCTGAGAGAGATGCCAAGAATTGATGAGCTTTATTCTGATTGAAATGAATAGTAC ATGGAAGCACCTCATTCAACTAGGGTTGTGATTATTGACACCAAGTACGTGCAAACGGATGCCAAGAGCTTCAAGACAGTGGTGCAAAAGCTGACAGGCAAAGATTCGGTGGTGACAGTGGCTGAGGAAACCCGACGACAAACTGGTAGTGCCCGAAACTCGAGTCTTTTGAGAGATTCATCGTTCAAAGAGTTTCAAAGGGTGCTGAGAGAGATGCCAAGAATTGATGAGCTTTATTCTGATTGA MEAPHSTRVVIIDTKYVQTDAKSFKTVVQKLTGKDSVVTVAEETRRQTGSARNSSLLRDSSFKEFQRVLREMPRIDELYSD* Homology
BLAST of CsGy4G007530.1 vs. ExPASy Swiss-Prot
Match: Q8VYI5 (VQ motif-containing protein 10 OS=Arabidopsis thaliana OX=3702 GN=VQ10 PE=1 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.2e-07 Identity = 35/92 (38.04%), Postives = 52/92 (56.52%), Query Frame = 0
BLAST of CsGy4G007530.1 vs. ExPASy Swiss-Prot
Match: Q1G3U8 (VQ motif-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=VQ1 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.3e-06 Identity = 34/85 (40.00%), Postives = 49/85 (57.65%), Query Frame = 0
BLAST of CsGy4G007530.1 vs. NCBI nr
Match: KGN53544.1 (hypothetical protein Csa_014778 [Cucumis sativus]) HSP 1 Score: 155 bits (391), Expect = 2.71e-47 Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of CsGy4G007530.1 vs. NCBI nr
Match: KAA0063001.1 (VQ motif-containing protein 1-like [Cucumis melo var. makuwa] >TYK16346.1 VQ motif-containing protein 1-like [Cucumis melo var. makuwa]) HSP 1 Score: 146 bits (368), Expect = 8.77e-44 Identity = 77/81 (95.06%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of CsGy4G007530.1 vs. NCBI nr
Match: XP_038889427.1 (VQ motif-containing protein 1-like [Benincasa hispida]) HSP 1 Score: 131 bits (329), Expect = 7.17e-38 Identity = 71/81 (87.65%), Postives = 71/81 (87.65%), Query Frame = 0
BLAST of CsGy4G007530.1 vs. NCBI nr
Match: KAG6577059.1 (VQ motif-containing protein 1, partial [Cucurbita argyrosperma subsp. sororia] >KAG7015070.1 VQ motif-containing protein 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 108 bits (270), Expect = 5.89e-29 Identity = 63/74 (85.14%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of CsGy4G007530.1 vs. NCBI nr
Match: XP_022142787.1 (VQ motif-containing protein 10-like [Momordica charantia]) HSP 1 Score: 94.4 bits (233), Expect = 3.03e-23 Identity = 53/73 (72.60%), Postives = 57/73 (78.08%), Query Frame = 0
BLAST of CsGy4G007530.1 vs. ExPASy TrEMBL
Match: A0A0A0KXJ0 (VQ domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_4G075740 PE=4 SV=1) HSP 1 Score: 155 bits (391), Expect = 1.31e-47 Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of CsGy4G007530.1 vs. ExPASy TrEMBL
Match: A0A5A7VBD1 (VQ motif-containing protein 1-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold21G001280 PE=4 SV=1) HSP 1 Score: 146 bits (368), Expect = 4.25e-44 Identity = 77/81 (95.06%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of CsGy4G007530.1 vs. ExPASy TrEMBL
Match: A0A6J1CNV7 (VQ motif-containing protein 10-like OS=Momordica charantia OX=3673 GN=LOC111012826 PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 1.47e-23 Identity = 53/73 (72.60%), Postives = 57/73 (78.08%), Query Frame = 0
BLAST of CsGy4G007530.1 vs. ExPASy TrEMBL
Match: A0A6J1FVF7 (VQ motif-containing protein 1 OS=Cucurbita moschata OX=3662 GN=LOC111447218 PE=4 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.59e-20 Identity = 48/71 (67.61%), Postives = 54/71 (76.06%), Query Frame = 0
BLAST of CsGy4G007530.1 vs. ExPASy TrEMBL
Match: A0A0L9UJH2 (VQ domain-containing protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan05g031100 PE=4 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 5.82e-18 Identity = 43/76 (56.58%), Postives = 57/76 (75.00%), Query Frame = 0
BLAST of CsGy4G007530.1 vs. TAIR 10
Match: AT1G78410.1 (VQ motif-containing protein ) HSP 1 Score: 57.0 bits (136), Expect = 8.3e-09 Identity = 35/92 (38.04%), Postives = 52/92 (56.52%), Query Frame = 0
BLAST of CsGy4G007530.1 vs. TAIR 10
Match: AT1G17147.1 (VQ motif-containing protein ) HSP 1 Score: 53.5 bits (127), Expect = 9.1e-08 Identity = 34/85 (40.00%), Postives = 49/85 (57.65%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Gy14) v2.1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following five_prime_UTR feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|