CsGy2G012956.1 (mRNA) Cucumber (Gy14) v2.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGTTTAGATTGCTATCTTTGGTTCCTCATGCCAAGCAAATCTTGAAGATGCAGTCAGGGTTTACCAAAAACCAACTGAATGTTCCAAAAGGCCATGTTGCCGTTTATGTGGGAGAGATTCAAAGGAAGCGCTTTGTGGTTCCGATATCTTACTTAAACGATCCATCGTTCCAGCAACTGCTCAGCCATGCAGAGGAAGAGTTTGGCTTTCATCATCCTCATGGGGGTCTAACTATTCCTTGCAAAGAAGATGCCTTTGTTGATCTCACTTCTAGATTGCAAGTAGCTTGA ATGGGGTTTAGATTGCTATCTTTGGTTCCTCATGCCAAGCAAATCTTGAAGATGCAGTCAGGGTTTACCAAAAACCAACTGAATGTTCCAAAAGGCCATGTTGCCGTTTATGTGGGAGAGATTCAAAGGAAGCGCTTTGTGGTTCCGATATCTTACTTAAACGATCCATCGTTCCAGCAACTGCTCAGCCATGCAGAGGAAGAGTTTGGCTTTCATCATCCTCATGGGGGTCTAACTATTCCTTGCAAAGAAGATGCCTTTGTTGATCTCACTTCTAGATTGCAAGTAGCTTGA ATGGGGTTTAGATTGCTATCTTTGGTTCCTCATGCCAAGCAAATCTTGAAGATGCAGTCAGGGTTTACCAAAAACCAACTGAATGTTCCAAAAGGCCATGTTGCCGTTTATGTGGGAGAGATTCAAAGGAAGCGCTTTGTGGTTCCGATATCTTACTTAAACGATCCATCGTTCCAGCAACTGCTCAGCCATGCAGAGGAAGAGTTTGGCTTTCATCATCCTCATGGGGGTCTAACTATTCCTTGCAAAGAAGATGCCTTTGTTGATCTCACTTCTAGATTGCAAGTAGCTTGA MGFRLLSLVPHAKQILKMQSGFTKNQLNVPKGHVAVYVGEIQRKRFVVPISYLNDPSFQQLLSHAEEEFGFHHPHGGLTIPCKEDAFVDLTSRLQVA* Homology
BLAST of CsGy2G012956.1 vs. ExPASy Swiss-Prot
Match: Q9FK62 (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana OX=3702 GN=SAUR24 PE=2 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 4.8e-24 Identity = 53/84 (63.10%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. ExPASy Swiss-Prot
Match: Q9FJG0 (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana OX=3702 GN=SAUR20 PE=1 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.4e-23 Identity = 51/79 (64.56%), Postives = 60/79 (75.95%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. ExPASy Swiss-Prot
Match: Q9FJF7 (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana OX=3702 GN=SAUR22 PE=2 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 4.0e-23 Identity = 47/66 (71.21%), Postives = 57/66 (86.36%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. ExPASy Swiss-Prot
Match: Q9FJF9 (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana OX=3702 GN=SAUR21 PE=2 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 6.9e-23 Identity = 47/66 (71.21%), Postives = 57/66 (86.36%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. ExPASy Swiss-Prot
Match: Q9FJG1 (Auxin-responsive protein SAUR19 OS=Arabidopsis thaliana OX=3702 GN=SAUR19 PE=2 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 9.0e-23 Identity = 47/66 (71.21%), Postives = 57/66 (86.36%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. NCBI nr
Match: XP_031736841.1 (auxin-responsive protein SAUR24-like [Cucumis sativus] >KGN61876.1 hypothetical protein Csa_006109 [Cucumis sativus]) HSP 1 Score: 201 bits (510), Expect = 5.96e-65 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. NCBI nr
Match: XP_008457632.1 (PREDICTED: auxin-responsive protein SAUR24-like [Cucumis melo] >KAA0045674.1 auxin-responsive protein SAUR24-like [Cucumis melo var. makuwa] >TYJ99609.1 auxin-responsive protein SAUR24-like [Cucumis melo var. makuwa]) HSP 1 Score: 192 bits (489), Expect = 9.54e-62 Identity = 93/97 (95.88%), Postives = 95/97 (97.94%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. NCBI nr
Match: XP_016902164.1 (PREDICTED: auxin-responsive protein SAUR24-like [Cucumis melo] >KAA0045676.1 auxin-responsive protein SAUR24-like [Cucumis melo var. makuwa] >TYJ99607.1 auxin-responsive protein SAUR24-like [Cucumis melo var. makuwa]) HSP 1 Score: 187 bits (474), Expect = 1.86e-59 Identity = 90/97 (92.78%), Postives = 94/97 (96.91%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. NCBI nr
Match: XP_022944365.1 (auxin-responsive protein SAUR24-like [Cucurbita moschata] >XP_022944367.1 auxin-responsive protein SAUR24-like [Cucurbita moschata] >XP_022986731.1 auxin-responsive protein SAUR24-like [Cucurbita maxima] >XP_022986733.1 auxin-responsive protein SAUR24-like [Cucurbita maxima] >XP_022986734.1 auxin-responsive protein SAUR24-like [Cucurbita maxima] >XP_022986735.1 auxin-responsive protein SAUR24-like [Cucurbita maxima] >KAG6571048.1 Auxin-responsive protein SAUR24, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 186 bits (472), Expect = 3.75e-59 Identity = 89/97 (91.75%), Postives = 93/97 (95.88%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. NCBI nr
Match: XP_022944366.1 (auxin-responsive protein SAUR24-like [Cucurbita moschata] >KAG6571052.1 Auxin-responsive protein SAUR24, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 185 bits (469), Expect = 1.07e-58 Identity = 88/97 (90.72%), Postives = 93/97 (95.88%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. ExPASy TrEMBL
Match: A0A0A0LPI0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G258720 PE=3 SV=1) HSP 1 Score: 201 bits (510), Expect = 2.88e-65 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. ExPASy TrEMBL
Match: A0A5A7TRJ5 (Auxin-responsive protein SAUR24-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold123G001830 PE=3 SV=1) HSP 1 Score: 192 bits (489), Expect = 4.62e-62 Identity = 93/97 (95.88%), Postives = 95/97 (97.94%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. ExPASy TrEMBL
Match: A0A1S3C5I3 (auxin-responsive protein SAUR24-like OS=Cucumis melo OX=3656 GN=LOC103497281 PE=3 SV=1) HSP 1 Score: 192 bits (489), Expect = 4.62e-62 Identity = 93/97 (95.88%), Postives = 95/97 (97.94%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. ExPASy TrEMBL
Match: A0A5A7TU68 (Auxin-responsive protein SAUR24-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold123G001810 PE=3 SV=1) HSP 1 Score: 187 bits (474), Expect = 8.98e-60 Identity = 90/97 (92.78%), Postives = 94/97 (96.91%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. ExPASy TrEMBL
Match: A0A1S4E1Q9 (auxin-responsive protein SAUR24-like OS=Cucumis melo OX=3656 GN=LOC107991561 PE=3 SV=1) HSP 1 Score: 187 bits (474), Expect = 8.98e-60 Identity = 90/97 (92.78%), Postives = 94/97 (96.91%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. TAIR 10
Match: AT4G34810.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 115.2 bits (287), Expect = 3.1e-26 Identity = 60/105 (57.14%), Postives = 76/105 (72.38%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. TAIR 10
Match: AT4G38840.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 114.8 bits (286), Expect = 4.0e-26 Identity = 55/97 (56.70%), Postives = 70/97 (72.16%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. TAIR 10
Match: AT2G21210.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 113.6 bits (283), Expect = 8.9e-26 Identity = 54/98 (55.10%), Postives = 72/98 (73.47%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. TAIR 10
Match: AT5G18080.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 111.7 bits (278), Expect = 3.4e-25 Identity = 53/84 (63.10%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of CsGy2G012956.1 vs. TAIR 10
Match: AT5G18020.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 109.4 bits (272), Expect = 1.7e-24 Identity = 51/79 (64.56%), Postives = 60/79 (75.95%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Gy14) v2.1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|