CsGy1G023850.1 (mRNA) Cucumber (Gy14) v2.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGTCCGCTGAGATTGATTCTCATATTTCTCTCAGCGACTCTTGCAGGCTTCTTCCTTATCCGTAACCTCAAATCTCCCTCTCAAGATTTCCACGCCGATGACCATACTTCCGATTCCAATTCCTCTTCATCCCCCAACTCCAACAAGGTCCTTCTTTCTCTCTCTTCTAATACAATTCTTTTTTAATTTCTTCCATTTCAATATCAAATCTTTCTTTCATTAATTGGTGTGTACGTACGTGCTGTATATATATATATATATGTTTGAACAGATCTCATCGGGGTTCTGGACGGTGGTAGATATGGCTTCCGGTCGCTACTTATGGAGGCATTTGTTTTCGTCGTCATCGTCGGAGAAGGCTTCCGATTGA ATGTGTCCGCTGAGATTGATTCTCATATTTCTCTCAGCGACTCTTGCAGGCTTCTTCCTTATCCGTAACCTCAAATCTCCCTCTCAAGATTTCCACGCCGATGACCATACTTCCGATTCCAATTCCTCTTCATCCCCCAACTCCAACAAGATCTCATCGGGGTTCTGGACGGTGGTAGATATGGCTTCCGGTCGCTACTTATGGAGGCATTTGTTTTCGTCGTCATCGTCGGAGAAGGCTTCCGATTGA ATGTGTCCGCTGAGATTGATTCTCATATTTCTCTCAGCGACTCTTGCAGGCTTCTTCCTTATCCGTAACCTCAAATCTCCCTCTCAAGATTTCCACGCCGATGACCATACTTCCGATTCCAATTCCTCTTCATCCCCCAACTCCAACAAGATCTCATCGGGGTTCTGGACGGTGGTAGATATGGCTTCCGGTCGCTACTTATGGAGGCATTTGTTTTCGTCGTCATCGTCGGAGAAGGCTTCCGATTGA MCPLRLILIFLSATLAGFFLIRNLKSPSQDFHADDHTSDSNSSSSPNSNKISSGFWTVVDMASGRYLWRHLFSSSSSEKASD* Homology
BLAST of CsGy1G023850.1 vs. NCBI nr
Match: KGN65855.1 (hypothetical protein Csa_023267 [Cucumis sativus]) HSP 1 Score: 154 bits (390), Expect = 4.14e-47 Identity = 80/82 (97.56%), Postives = 80/82 (97.56%), Query Frame = 0
BLAST of CsGy1G023850.1 vs. NCBI nr
Match: KAA0060005.1 (putative Methyltransferase-related protein [Cucumis melo var. makuwa] >TYJ97263.1 putative Methyltransferase-related protein [Cucumis melo var. makuwa]) HSP 1 Score: 149 bits (377), Expect = 3.87e-45 Identity = 79/82 (96.34%), Postives = 79/82 (96.34%), Query Frame = 0
BLAST of CsGy1G023850.1 vs. NCBI nr
Match: XP_038895770.1 (uncharacterized protein LOC120083933 [Benincasa hispida]) HSP 1 Score: 120 bits (300), Expect = 2.42e-33 Identity = 69/88 (78.41%), Postives = 75/88 (85.23%), Query Frame = 0
BLAST of CsGy1G023850.1 vs. NCBI nr
Match: XP_022154856.1 (uncharacterized protein LOC111022014 [Momordica charantia]) HSP 1 Score: 114 bits (284), Expect = 7.26e-31 Identity = 63/88 (71.59%), Postives = 72/88 (81.82%), Query Frame = 0
BLAST of CsGy1G023850.1 vs. NCBI nr
Match: XP_008453499.1 (PREDICTED: uncharacterized protein LOC103494193 [Cucumis melo]) HSP 1 Score: 106 bits (265), Expect = 5.10e-28 Identity = 60/86 (69.77%), Postives = 69/86 (80.23%), Query Frame = 0
BLAST of CsGy1G023850.1 vs. ExPASy TrEMBL
Match: A0A0A0LVB2 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G533620 PE=4 SV=1) HSP 1 Score: 154 bits (390), Expect = 2.00e-47 Identity = 80/82 (97.56%), Postives = 80/82 (97.56%), Query Frame = 0
BLAST of CsGy1G023850.1 vs. ExPASy TrEMBL
Match: A0A5A7V291 (Putative Methyltransferase-related protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold194G00570 PE=4 SV=1) HSP 1 Score: 149 bits (377), Expect = 1.87e-45 Identity = 79/82 (96.34%), Postives = 79/82 (96.34%), Query Frame = 0
BLAST of CsGy1G023850.1 vs. ExPASy TrEMBL
Match: A0A6J1DPZ0 (uncharacterized protein LOC111022014 OS=Momordica charantia OX=3673 GN=LOC111022014 PE=4 SV=1) HSP 1 Score: 114 bits (284), Expect = 3.52e-31 Identity = 63/88 (71.59%), Postives = 72/88 (81.82%), Query Frame = 0
BLAST of CsGy1G023850.1 vs. ExPASy TrEMBL
Match: A0A1S3BWD8 (uncharacterized protein LOC103494193 OS=Cucumis melo OX=3656 GN=LOC103494193 PE=4 SV=1) HSP 1 Score: 106 bits (265), Expect = 2.47e-28 Identity = 60/86 (69.77%), Postives = 69/86 (80.23%), Query Frame = 0
BLAST of CsGy1G023850.1 vs. ExPASy TrEMBL
Match: A0A0A0LV42 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G025180 PE=4 SV=1) HSP 1 Score: 105 bits (261), Expect = 1.00e-27 Identity = 57/86 (66.28%), Postives = 71/86 (82.56%), Query Frame = 0
BLAST of CsGy1G023850.1 vs. TAIR 10
Match: AT5G58375.1 (Methyltransferase-related protein ) HSP 1 Score: 77.4 bits (189), Expect = 6.0e-15 Identity = 48/84 (57.14%), Postives = 55/84 (65.48%), Query Frame = 0
BLAST of CsGy1G023850.1 vs. TAIR 10
Match: AT5G18150.1 (Methyltransferase-related protein ) HSP 1 Score: 60.5 bits (145), Expect = 7.6e-10 Identity = 32/71 (45.07%), Postives = 46/71 (64.79%), Query Frame = 0
BLAST of CsGy1G023850.1 vs. TAIR 10
Match: AT5G14602.1 (FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; BEST Arabidopsis thaliana protein match is: Methyltransferase-related protein (TAIR:AT5G18150.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 57.4 bits (137), Expect = 6.4e-09 Identity = 31/72 (43.06%), Postives = 44/72 (61.11%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Gy14) v2.1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|