
Cmc08g0208051.1 (mRNA) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCATTTTACAACGGCCCCCAATTGAATTTGTTTAACAATCACCATCATCTCTTTCCTATCCATAAACCTAATAATAATCACCATTCTTCTTCTCTTTCATTGCCCAATTCCTGGTTGATGGGTTGCTTTTTGATGCTATCTTCCAATACCTTATGGAGTGTTTGGGTTGTTCTTCAGGTACCAATTTTCAAATATTCTTCTAATCATTTGTTTGGATATATCAATTTTTGTTACAATAATTATATTATTTGAAAAAACAGGCATTGGTATTGAAAAGCTATTCTTTCAAGCTTCAGTTGACAAATCTTCAATGTTTATTAAGCTCATTTCAATCATTTGATATTGCCATTGTAATGGAAAGACAACCTCATAAATGTAAACTTGGTTGGAATCTTCAACTTCTTGCAGTCATATATTGTGTAATTTTGTCTCTATATCCACTTTAA ATGGCATTTTACAACGGCCCCCAATTGAATTTGTTTAACAATCACCATCATCTCTTTCCTATCCATAAACCTAATAATAATCACCATTCTTCTTCTCTTTCATTGCCCAATTCCTGGTTGATGGGTTGCTTTTTGATGCTATCTTCCAATACCTTATGGAGTGTTTGGGTTGTTCTTCAGGCATTGGTATTGAAAAGCTATTCTTTCAAGCTTCAGTTGACAAATCTTCAATGTTTATTAAGCTCATTTCAATCATTTGATATTGCCATTGTAATGGAAAGACAACCTCATAAATGTAAACTTGGTTGGAATCTTCAACTTCTTGCAGTCATATATTGTGTAATTTTGTCTCTATATCCACTTTAA ATGGCATTTTACAACGGCCCCCAATTGAATTTGTTTAACAATCACCATCATCTCTTTCCTATCCATAAACCTAATAATAATCACCATTCTTCTTCTCTTTCATTGCCCAATTCCTGGTTGATGGGTTGCTTTTTGATGCTATCTTCCAATACCTTATGGAGTGTTTGGGTTGTTCTTCAGGCATTGGTATTGAAAAGCTATTCTTTCAAGCTTCAGTTGACAAATCTTCAATGTTTATTAAGCTCATTTCAATCATTTGATATTGCCATTGTAATGGAAAGACAACCTCATAAATGTAAACTTGGTTGGAATCTTCAACTTCTTGCAGTCATATATTGTGTAATTTTGTCTCTATATCCACTTTAA MAFYNGPQLNLFNNHHHLFPIHKPNNNHHSSSLSLPNSWLMGCFLMLSSNTLWSVWVVLQALVLKSYSFKLQLTNLQCLLSSFQSFDIAIVMERQPHKCKLGWNLQLLAVIYCVILSLYPL Homology
BLAST of Cmc08g0208051.1 vs. NCBI nr
Match: KAA0040784.1 (WAT1-related protein [Cucumis melo var. makuwa]) HSP 1 Score: 218.4 bits (555), Expect = 3.4e-53 Identity = 107/117 (91.45%), Postives = 111/117 (94.87%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. NCBI nr
Match: XP_008460917.1 (PREDICTED: WAT1-related protein At5g64700-like isoform X2 [Cucumis melo]) HSP 1 Score: 218.4 bits (555), Expect = 3.4e-53 Identity = 107/117 (91.45%), Postives = 111/117 (94.87%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. NCBI nr
Match: TYK02100.1 (WAT1-related protein [Cucumis melo var. makuwa]) HSP 1 Score: 218.4 bits (555), Expect = 3.4e-53 Identity = 107/117 (91.45%), Postives = 111/117 (94.87%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. NCBI nr
Match: XP_008460916.1 (PREDICTED: WAT1-related protein At5g64700-like isoform X1 [Cucumis melo]) HSP 1 Score: 218.4 bits (555), Expect = 3.4e-53 Identity = 107/117 (91.45%), Postives = 111/117 (94.87%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. NCBI nr
Match: XP_031737230.1 (WAT1-related protein At5g64700 [Cucumis sativus]) HSP 1 Score: 187.6 bits (475), Expect = 6.4e-44 Identity = 98/118 (83.05%), Postives = 103/118 (87.29%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. ExPASy Swiss-Prot
Match: Q9FGG3 (WAT1-related protein At5g64700 OS=Arabidopsis thaliana OX=3702 GN=At5g64700 PE=2 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 2.3e-20 Identity = 57/113 (50.44%), Postives = 67/113 (59.29%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. ExPASy Swiss-Prot
Match: Q9SUF1 (WAT1-related protein At4g08290 OS=Arabidopsis thaliana OX=3702 GN=At4g08290 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 9.7e-11 Identity = 42/120 (35.00%), Postives = 65/120 (54.17%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. ExPASy Swiss-Prot
Match: Q6NMB7 (WAT1-related protein At1g43650 OS=Arabidopsis thaliana OX=3702 GN=At1g43650 PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 3.1e-09 Identity = 43/115 (37.39%), Postives = 63/115 (54.78%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. ExPASy Swiss-Prot
Match: F4IJ08 (WAT1-related protein At2g40900 OS=Arabidopsis thaliana OX=3702 GN=At2g40900 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 5.9e-08 Identity = 37/118 (31.36%), Postives = 60/118 (50.85%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. ExPASy Swiss-Prot
Match: Q9FL41 (WAT1-related protein At5g07050 OS=Arabidopsis thaliana OX=3702 GN=At5g07050 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.3e-07 Identity = 37/118 (31.36%), Postives = 59/118 (50.00%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. ExPASy TrEMBL
Match: A0A5D3BSL4 (WAT1-related protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold680G00870 PE=3 SV=1) HSP 1 Score: 218.4 bits (555), Expect = 1.6e-53 Identity = 107/117 (91.45%), Postives = 111/117 (94.87%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. ExPASy TrEMBL
Match: A0A5A7TBE1 (WAT1-related protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold703G00520 PE=3 SV=1) HSP 1 Score: 218.4 bits (555), Expect = 1.6e-53 Identity = 107/117 (91.45%), Postives = 111/117 (94.87%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. ExPASy TrEMBL
Match: A0A1S3CER4 (WAT1-related protein OS=Cucumis melo OX=3656 GN=LOC103499657 PE=3 SV=1) HSP 1 Score: 218.4 bits (555), Expect = 1.6e-53 Identity = 107/117 (91.45%), Postives = 111/117 (94.87%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. ExPASy TrEMBL
Match: A0A1S3CDZ8 (WAT1-related protein OS=Cucumis melo OX=3656 GN=LOC103499657 PE=3 SV=1) HSP 1 Score: 218.4 bits (555), Expect = 1.6e-53 Identity = 107/117 (91.45%), Postives = 111/117 (94.87%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. ExPASy TrEMBL
Match: A0A0A0LM69 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G301470 PE=4 SV=1) HSP 1 Score: 197.6 bits (501), Expect = 3.0e-47 Identity = 105/122 (86.07%), Postives = 107/122 (87.70%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. TAIR 10
Match: AT5G64700.1 (nodulin MtN21 /EamA-like transporter family protein ) HSP 1 Score: 99.8 bits (247), Expect = 1.6e-21 Identity = 57/113 (50.44%), Postives = 67/113 (59.29%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. TAIR 10
Match: AT4G08290.1 (nodulin MtN21 /EamA-like transporter family protein ) HSP 1 Score: 67.8 bits (164), Expect = 6.9e-12 Identity = 42/120 (35.00%), Postives = 65/120 (54.17%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. TAIR 10
Match: AT4G08290.2 (nodulin MtN21 /EamA-like transporter family protein ) HSP 1 Score: 67.0 bits (162), Expect = 1.2e-11 Identity = 43/124 (34.68%), Postives = 66/124 (53.23%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. TAIR 10
Match: AT1G43650.1 (nodulin MtN21 /EamA-like transporter family protein ) HSP 1 Score: 62.8 bits (151), Expect = 2.2e-10 Identity = 43/115 (37.39%), Postives = 63/115 (54.78%), Query Frame = 0
BLAST of Cmc08g0208051.1 vs. TAIR 10
Match: AT5G07050.1 (nodulin MtN21 /EamA-like transporter family protein ) HSP 1 Score: 57.4 bits (137), Expect = 9.3e-09 Identity = 37/118 (31.36%), Postives = 59/118 (50.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|