
Cmc07g0185241.1 (mRNA) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAAAAGGAGGGAATAGATTATGAAGAAACTTTCTCTCATATTGCCATGATAAAGTCGATTAGAATACTCTTATCCATCGCCACTTTTTATGATTATGAAATTTGGCAGATGGATGTCAAGACAGCGTTTTTGAATGGAAATCTTGAAGAGAGTATCTATATGGTCCAACTAGAGGGGTTTATACAAAAGGATCAAGAACAAAAAGTTTATAAACTTCAAAAATCCATTTATGGATTAAAACAAGCATCTAGATCCTGGAATATAAGATTTGATACTGCGATCAAATCTTATCGTTTTGAACAGAATATTGATGAACCTTGTGTTTACAAAAGGATCATAAATTTTACTGTTGTATTCTTAGTTCTGTATGTAAATGACATTCTACTCATTGGGAATGATGTAGGTCATCTAACTGATATTAAGTAA ATGCAAAAGGAGGGAATAGATTATGAAGAAACTTTCTCTCATATTGCCATGATAAAGTCGATTAGAATACTCTTATCCATCGCCACTTTTTATGATTATGAAATTTGGCAGATGGATGTCAAGACAGCGTTTTTGAATGGAAATCTTGAAGAGAGTATCTATATGGTCCAACTAGAGGGGTTTATACAAAAGGATCAAGAACAAAAAGTTTATAAACTTCAAAAATCCATTTATGGATTAAAACAAGCATCTAGATCCTGGAATATAAGATTTGATACTGCGATCAAATCTTATCGTTTTGAACAGAATATTGATGAACCTTGTGTTTACAAAAGGATCATAAATTTTACTGTTGTATTCTTAGTTCTGTATGTAAATGACATTCTACTCATTGGGAATGATGTAGGTCATCTAACTGATATTAAGTAA ATGCAAAAGGAGGGAATAGATTATGAAGAAACTTTCTCTCATATTGCCATGATAAAGTCGATTAGAATACTCTTATCCATCGCCACTTTTTATGATTATGAAATTTGGCAGATGGATGTCAAGACAGCGTTTTTGAATGGAAATCTTGAAGAGAGTATCTATATGGTCCAACTAGAGGGGTTTATACAAAAGGATCAAGAACAAAAAGTTTATAAACTTCAAAAATCCATTTATGGATTAAAACAAGCATCTAGATCCTGGAATATAAGATTTGATACTGCGATCAAATCTTATCGTTTTGAACAGAATATTGATGAACCTTGTGTTTACAAAAGGATCATAAATTTTACTGTTGTATTCTTAGTTCTGTATGTAAATGACATTCTACTCATTGGGAATGATGTAGGTCATCTAACTGATATTAAGTAA MQKEGIDYEETFSHIAMIKSIRILLSIATFYDYEIWQMDVKTAFLNGNLEESIYMVQLEGFIQKDQEQKVYKLQKSIYGLKQASRSWNIRFDTAIKSYRFEQNIDEPCVYKRIINFTVVFLVLYVNDILLIGNDVGHLTDIK Homology
BLAST of Cmc07g0185241.1 vs. NCBI nr
Match: KAA0045356.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 253.1 bits (645), Expect = 1.5e-63 Identity = 129/141 (91.49%), Postives = 132/141 (93.62%), Query Frame = 0
BLAST of Cmc07g0185241.1 vs. NCBI nr
Match: ADJ18449.1 (gag/pol protein, partial [Bryonia dioica]) HSP 1 Score: 244.6 bits (623), Expect = 5.2e-61 Identity = 120/141 (85.11%), Postives = 132/141 (93.62%), Query Frame = 0
BLAST of Cmc07g0185241.1 vs. NCBI nr
Match: KAA0043610.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 235.7 bits (600), Expect = 2.4e-58 Identity = 118/142 (83.10%), Postives = 130/142 (91.55%), Query Frame = 0
BLAST of Cmc07g0185241.1 vs. NCBI nr
Match: KAA0065369.1 (gag/pol protein [Cucumis melo var. makuwa] >TYK20866.1 gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 235.3 bits (599), Expect = 3.2e-58 Identity = 118/141 (83.69%), Postives = 129/141 (91.49%), Query Frame = 0
BLAST of Cmc07g0185241.1 vs. NCBI nr
Match: KAA0058278.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 233.8 bits (595), Expect = 9.2e-58 Identity = 115/141 (81.56%), Postives = 128/141 (90.78%), Query Frame = 0
BLAST of Cmc07g0185241.1 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 2.2e-30 Identity = 68/142 (47.89%), Postives = 97/142 (68.31%), Query Frame = 0
BLAST of Cmc07g0185241.1 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 2.2e-22 Identity = 53/133 (39.85%), Postives = 84/133 (63.16%), Query Frame = 0
BLAST of Cmc07g0185241.1 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 4.9e-22 Identity = 53/133 (39.85%), Postives = 83/133 (62.41%), Query Frame = 0
BLAST of Cmc07g0185241.1 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 104.8 bits (260), Expect = 8.4e-22 Identity = 61/144 (42.36%), Postives = 88/144 (61.11%), Query Frame = 0
BLAST of Cmc07g0185241.1 vs. ExPASy Swiss-Prot
Match: P25600 (Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY5A PE=5 SV=2) HSP 1 Score: 62.4 bits (150), Expect = 4.8e-09 Identity = 33/93 (35.48%), Postives = 54/93 (58.06%), Query Frame = 0
BLAST of Cmc07g0185241.1 vs. ExPASy TrEMBL
Match: A0A5A7TTA2 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold316G001350 PE=4 SV=1) HSP 1 Score: 253.1 bits (645), Expect = 7.1e-64 Identity = 129/141 (91.49%), Postives = 132/141 (93.62%), Query Frame = 0
BLAST of Cmc07g0185241.1 vs. ExPASy TrEMBL
Match: E2GK51 (Gag/pol protein (Fragment) OS=Bryonia dioica OX=3652 PE=4 SV=1) HSP 1 Score: 244.6 bits (623), Expect = 2.5e-61 Identity = 120/141 (85.11%), Postives = 132/141 (93.62%), Query Frame = 0
BLAST of Cmc07g0185241.1 vs. ExPASy TrEMBL
Match: A0A5A7TK28 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold320G00480 PE=4 SV=1) HSP 1 Score: 235.7 bits (600), Expect = 1.2e-58 Identity = 118/142 (83.10%), Postives = 130/142 (91.55%), Query Frame = 0
BLAST of Cmc07g0185241.1 vs. ExPASy TrEMBL
Match: A0A5A7VIS5 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold682G00310 PE=4 SV=1) HSP 1 Score: 235.3 bits (599), Expect = 1.5e-58 Identity = 118/141 (83.69%), Postives = 129/141 (91.49%), Query Frame = 0
BLAST of Cmc07g0185241.1 vs. ExPASy TrEMBL
Match: A0A5A7USZ2 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold274G006070 PE=4 SV=1) HSP 1 Score: 233.8 bits (595), Expect = 4.4e-58 Identity = 115/141 (81.56%), Postives = 128/141 (90.78%), Query Frame = 0
BLAST of Cmc07g0185241.1 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 100.1 bits (248), Expect = 1.5e-21 Identity = 50/145 (34.48%), Postives = 90/145 (62.07%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|