
Cmc04g0087491.1 (mRNA) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATTGTTTTACGGTTCTTAAGGGATACAATTTTATCCTAATCAACCGACTTTATCGAGAAATATTACTTTTTTTAGGCCAAGAGGTTGATAGTGAGATTTTGAATCAACTCATTGGTCTTATAGTATATCTCAGTATGGAGGATGATACCAAAGATCTGTATTTATTTATAAACTCTCCCGGTGGAGGGGTAATAGGCGGAGTAGGTATTTATGATACTATGCAATTTGTGCAACCTCATGTACAGACAATATGCATGGAATTAGCCGCTTCAATGGGATCTTTTATTCTAGTCGGAGGAGAAATTACCAAATGTCTAGCATTCCCGCAAGCTTGTTTTTTTCAAAAACAAAATGAGACAACAAATAAATGTTACTATAGTTCATTTGTACTAAACATGCAAAAATAG ATGGATTGTTTTACGGTTCTTAAGGGATACAATTTTATCCTAATCAACCGACTTTATCGAGAAATATTACTTTTTTTAGGCCAAGAGGTTGATAGTGAGATTTTGAATCAACTCATTGGTCTTATAGTATATCTCAGTATGGAGGATGATACCAAAGATCTGTATTTATTTATAAACTCTCCCGGTGGAGGGGTAATAGGCGGAGTAGGTATTTATGATACTATGCAATTTGTGCAACCTCATGTACAGACAATATGCATGGAATTAGCCGCTTCAATGGGATCTTTTATTCTAGTCGGAGGAGAAATTACCAAATGTCTAGCATTCCCGCAAGCTTGTTTTTTTCAAAAACAAAATGAGACAACAAATAAATGTTACTATAGTTCATTTGTACTAAACATGCAAAAATAG ATGGATTGTTTTACGGTTCTTAAGGGATACAATTTTATCCTAATCAACCGACTTTATCGAGAAATATTACTTTTTTTAGGCCAAGAGGTTGATAGTGAGATTTTGAATCAACTCATTGGTCTTATAGTATATCTCAGTATGGAGGATGATACCAAAGATCTGTATTTATTTATAAACTCTCCCGGTGGAGGGGTAATAGGCGGAGTAGGTATTTATGATACTATGCAATTTGTGCAACCTCATGTACAGACAATATGCATGGAATTAGCCGCTTCAATGGGATCTTTTATTCTAGTCGGAGGAGAAATTACCAAATGTCTAGCATTCCCGCAAGCTTGTTTTTTTCAAAAACAAAATGAGACAACAAATAAATGTTACTATAGTTCATTTGTACTAAACATGCAAAAATAG MDCFTVLKGYNFILINRLYREILLFLGQEVDSEILNQLIGLIVYLSMEDDTKDLYLFINSPGGGVIGGVGIYDTMQFVQPHVQTICMELAASMGSFILVGGEITKCLAFPQACFFQKQNETTNKCYYSSFVLNMQK Homology
BLAST of Cmc04g0087491.1 vs. NCBI nr
Match: YP_009176028.1 (clp protease proteolytic subunit [Ficus racemosa] >ALI30724.1 clp protease proteolytic subunit [Ficus racemosa]) HSP 1 Score: 184.9 bits (468), Expect = 4.7e-43 Identity = 96/111 (86.49%), Postives = 99/111 (89.19%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. NCBI nr
Match: QEZ90582.1 (ClpP [Archidasyphyllum excelsum]) HSP 1 Score: 182.6 bits (462), Expect = 2.3e-42 Identity = 93/112 (83.04%), Postives = 98/112 (87.50%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. NCBI nr
Match: YP_009912275.1 (ClpP [Fulcaldea stuessyi] >QLD96795.1 ClpP [Fulcaldea stuessyi]) HSP 1 Score: 182.6 bits (462), Expect = 2.3e-42 Identity = 93/112 (83.04%), Postives = 98/112 (87.50%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. NCBI nr
Match: RXV70727.1 (ATP-dependent Clp protease proteolytic subunit [bacterium 1XD8-92]) HSP 1 Score: 182.6 bits (462), Expect = 2.3e-42 Identity = 97/114 (85.09%), Postives = 100/114 (87.72%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. NCBI nr
Match: QKY75378.1 (ClpP [Barnadesia lehmannii]) HSP 1 Score: 182.6 bits (462), Expect = 2.3e-42 Identity = 93/112 (83.04%), Postives = 99/112 (88.39%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. ExPASy Swiss-Prot
Match: Q09WZ2 (ATP-dependent Clp protease proteolytic subunit OS=Morus indica OX=248361 GN=clpP PE=3 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 1.3e-40 Identity = 86/99 (86.87%), Postives = 91/99 (91.92%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. ExPASy Swiss-Prot
Match: Q9M3K5 (ATP-dependent Clp protease proteolytic subunit OS=Spinacia oleracea OX=3562 GN=clpP PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 2.5e-39 Identity = 84/97 (86.60%), Postives = 87/97 (89.69%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. ExPASy Swiss-Prot
Match: Q0G9T7 (ATP-dependent Clp protease proteolytic subunit OS=Daucus carota OX=4039 GN=clpP PE=3 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 7.3e-39 Identity = 83/97 (85.57%), Postives = 87/97 (89.69%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. ExPASy Swiss-Prot
Match: Q3C1K4 (ATP-dependent Clp protease proteolytic subunit OS=Nicotiana sylvestris OX=4096 GN=clpP PE=3 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 7.3e-39 Identity = 83/97 (85.57%), Postives = 87/97 (89.69%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. ExPASy Swiss-Prot
Match: Q33C07 (ATP-dependent Clp protease proteolytic subunit OS=Nicotiana tomentosiformis OX=4098 GN=clpP PE=3 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 7.3e-39 Identity = 83/97 (85.57%), Postives = 87/97 (89.69%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. ExPASy TrEMBL
Match: A0A0N9XTU2 (ATP-dependent Clp protease proteolytic subunit OS=Ficus racemosa OX=100569 GN=clpP PE=3 SV=1) HSP 1 Score: 184.9 bits (468), Expect = 2.3e-43 Identity = 96/111 (86.49%), Postives = 99/111 (89.19%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. ExPASy TrEMBL
Match: A0A7D5FAA0 (ATP-dependent Clp protease proteolytic subunit OS=Fulcaldea stuessyi OX=1080004 GN=clpP PE=3 SV=1) HSP 1 Score: 182.6 bits (462), Expect = 1.1e-42 Identity = 93/112 (83.04%), Postives = 98/112 (87.50%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. ExPASy TrEMBL
Match: A0A5J6RKS0 (ATP-dependent Clp protease proteolytic subunit OS=Archidasyphyllum excelsum OX=171774 GN=clpP PE=3 SV=1) HSP 1 Score: 182.6 bits (462), Expect = 1.1e-42 Identity = 93/112 (83.04%), Postives = 98/112 (87.50%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. ExPASy TrEMBL
Match: A0A4Q2AMQ5 (ATP-dependent Clp protease proteolytic subunit OS=bacterium 1XD8-92 OX=2320884 GN=D6D47_47570 PE=3 SV=1) HSP 1 Score: 182.6 bits (462), Expect = 1.1e-42 Identity = 97/114 (85.09%), Postives = 100/114 (87.72%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. ExPASy TrEMBL
Match: A0A249RXJ0 (ATP-dependent Clp protease proteolytic subunit OS=Cucumis melo subsp. agrestis OX=217619 GN=clpP PE=3 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 5.6e-42 Identity = 91/102 (89.22%), Postives = 96/102 (94.12%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. TAIR 10
Match: ATCG00670.1 (plastid-encoded CLP P ) HSP 1 Score: 149.1 bits (375), Expect = 2.7e-36 Identity = 75/99 (75.76%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. TAIR 10
Match: AT1G02560.1 (nuclear encoded CLP protease 5 ) HSP 1 Score: 85.9 bits (211), Expect = 2.8e-17 Identity = 38/99 (38.38%), Postives = 66/99 (66.67%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. TAIR 10
Match: AT1G66670.1 (CLP protease proteolytic subunit 3 ) HSP 1 Score: 85.9 bits (211), Expect = 2.8e-17 Identity = 41/97 (42.27%), Postives = 60/97 (61.86%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. TAIR 10
Match: AT1G12410.1 (CLP protease proteolytic subunit 2 ) HSP 1 Score: 82.4 bits (202), Expect = 3.0e-16 Identity = 37/95 (38.95%), Postives = 60/95 (63.16%), Query Frame = 0
BLAST of Cmc04g0087491.1 vs. TAIR 10
Match: AT1G11750.1 (CLP protease proteolytic subunit 6 ) HSP 1 Score: 73.6 bits (179), Expect = 1.4e-13 Identity = 34/104 (32.69%), Postives = 60/104 (57.69%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|