
CmaCh18G005770.1 (mRNA) Cucurbita maxima (Rimu) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAACTCCGCGAGGGGGGCCATTGAACAGCTGGAAAAAGTCTGGGCCTGCTTACGAAAAGTCGAAATGGAAGCGGATCAGTTTAGAGTGAATGAATACTCTGAGATAGAATGAGAAAAATGGAATTTGATTAGTTCAACTTCTAAAAGTTTGGAACAATTAGAAAATTAGGAAAATGAAACATTTGTTTTGAACACCAAAAAGCCATTAATCAAGTACGACAACAGGTTTTCCAACAAGCCTTACAAGGAGCTCTAGGAACTCTGAATAGTTGTTTGAACAACGAGCTACGTTTACGTACCATCAATGCTAATATTTCCATTTCAAGCAAATGAAATTAGTAATATTATTCGTGAACGTATTGAGCAATATAATAGAGAAGTCAAAATTGTAAATACCGGTATTGTACTTCAAGTAGGCGACGACATTGCTCGTATTTATGGTCTTGATGAAGTAATGGCAGGTTCATTAGTCGAATTTGAAGAGGGTGCTATAGGCATAGCTCTAAATTGA ATGAAGAACTCCGCGAGGGGGGCCATTGAACAGCTGGAAAAAGTCTGGGCCTGCTTACGAAAAGTCGAAATGGAAGCGGATCAAGAAGTCAAAATTGTAAATACCGGTATTGTACTTCAAGTAGGCGACGACATTGCTCGTATTTATGGTCTTGATGAAGTAATGGCAGGTTCATTAGTCGAATTTGAAGAGGGTGCTATAGGCATAGCTCTAAATTGA ATGAAGAACTCCGCGAGGGGGGCCATTGAACAGCTGGAAAAAGTCTGGGCCTGCTTACGAAAAGTCGAAATGGAAGCGGATCAAGAAGTCAAAATTGTAAATACCGGTATTGTACTTCAAGTAGGCGACGACATTGCTCGTATTTATGGTCTTGATGAAGTAATGGCAGGTTCATTAGTCGAATTTGAAGAGGGTGCTATAGGCATAGCTCTAAATTGA MKNSARGAIEQLEKVWACLRKVEMEADQEVKIVNTGIVLQVGDDIARIYGLDEVMAGSLVEFEEGAIGIALN Homology
BLAST of CmaCh18G005770.1 vs. ExPASy Swiss-Prot
Match: A4QJA0 (ATP synthase subunit alpha, chloroplastic OS=Aethionema cordifolium OX=434059 GN=atpA PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.9e-14 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. ExPASy Swiss-Prot
Match: A4QJI4 (ATP synthase subunit alpha, chloroplastic OS=Aethionema grandiflorum OX=72657 GN=atpA PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.9e-14 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. ExPASy Swiss-Prot
Match: Q49L13 (ATP synthase subunit alpha, chloroplastic OS=Eucalyptus globulus subsp. globulus OX=71271 GN=atpA PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.9e-14 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. ExPASy Swiss-Prot
Match: B1NWD5 (ATP synthase subunit alpha, chloroplastic OS=Manihot esculenta OX=3983 GN=atpA PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.9e-14 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. ExPASy Swiss-Prot
Match: B0Z4N2 (ATP synthase subunit alpha, chloroplastic OS=Oenothera argillicola OX=3940 GN=atpA PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.9e-14 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. ExPASy TrEMBL
Match: A0A445A147 (ATP-synt_ab_N domain-containing protein OS=Arachis hypogaea OX=3818 GN=Ahy_B03g065254 PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 6.0e-19 Identity = 59/86 (68.60%), Postives = 61/86 (70.93%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. ExPASy TrEMBL
Match: A0A6A6LMU7 (Sm domain-containing protein OS=Hevea brasiliensis OX=3981 GN=GH714_018446 PE=3 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 1.1e-12 Identity = 41/46 (89.13%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. ExPASy TrEMBL
Match: A0A7S6PWK9 (ATP synthase CF1 alpha subunit OS=Eriophyton wallichii OX=694358 GN=atpA PE=4 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.4e-12 Identity = 43/62 (69.35%), Postives = 50/62 (80.65%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. ExPASy TrEMBL
Match: A0A2K9RJU3 (ATP synthase subunit alpha OS=Lamium galeobdolon OX=53161 GN=atpA PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.4e-12 Identity = 43/62 (69.35%), Postives = 50/62 (80.65%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. ExPASy TrEMBL
Match: A0A2K9RJL1 (ATP synthase subunit alpha OS=Lamium album OX=53159 GN=atpA PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.4e-12 Identity = 43/62 (69.35%), Postives = 50/62 (80.65%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. NCBI nr
Match: RYR20163.1 (hypothetical protein Ahy_B03g065254 [Arachis hypogaea]) HSP 1 Score: 102.8 bits (255), Expect = 1.2e-18 Identity = 59/86 (68.60%), Postives = 61/86 (70.93%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. NCBI nr
Match: KAF2300939.1 (hypothetical protein GH714_018446 [Hevea brasiliensis]) HSP 1 Score: 82.0 bits (201), Expect = 2.3e-12 Identity = 41/46 (89.13%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. NCBI nr
Match: YP_009461106.1 (ATP synthase CF1 alpha subunit [Lamium galeobdolon] >AUT82405.1 ATP synthase CF1 alpha subunit [Lamium galeobdolon]) HSP 1 Score: 81.6 bits (200), Expect = 3.0e-12 Identity = 43/62 (69.35%), Postives = 50/62 (80.65%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. NCBI nr
Match: YP_009461017.1 (ATP synthase CF1 alpha subunit [Lamium album] >YP_010029758.1 ATP synthase CF1 alpha subunit [Eriophyton wallichii] >AUT82316.1 ATP synthase CF1 alpha subunit [Lamium album] >QGX04479.1 ATP synthase CF1 alpha subunit [Lamium takeshimense] >QOU11442.1 ATP synthase CF1 alpha subunit [Eriophyton wallichii]) HSP 1 Score: 81.6 bits (200), Expect = 3.0e-12 Identity = 43/62 (69.35%), Postives = 50/62 (80.65%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. NCBI nr
Match: QVL26013.1 (ATP synthase CF1 alpha subunit [Lamium amplexicaule]) HSP 1 Score: 81.6 bits (200), Expect = 3.0e-12 Identity = 43/62 (69.35%), Postives = 50/62 (80.65%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. TAIR 10
Match: ATCG00120.1 (ATP synthase subunit alpha ) HSP 1 Score: 77.0 bits (188), Expect = 6.8e-15 Identity = 39/46 (84.78%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. TAIR 10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein ) HSP 1 Score: 43.9 bits (102), Expect = 6.4e-05 Identity = 20/37 (54.05%), Postives = 27/37 (72.97%), Query Frame = 0
BLAST of CmaCh18G005770.1 vs. TAIR 10
Match: ATMG01190.1 (ATP synthase subunit 1 ) HSP 1 Score: 43.9 bits (102), Expect = 6.4e-05 Identity = 20/37 (54.05%), Postives = 27/37 (72.97%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita maxima (Rimu) v1.1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|