
CmUC11G205880.1 (mRNA) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCACTGTCTTGCCTGTAACAGCAACATCAGCTAATTATGCAGCCAGTAACATCATGGACATTGAATCAATGTTCGATCTCGACACCGTCCTCACCGGAGCCGACGACTTCTATTACAACGAAAACGTTGTAGCGCCACCACCCGTGGTGGTCGCCGACTTGCCAACGGTGGCTGTTGAGGACGTATGTGCGGTTTGCATGGAGGATTTCCTGCCGAACGAAGGCGGTAAACAGATCGCCTGCGGGCATGTGTACCATCAATCTTGTATATCCTCTTGGCTCTCCGTCGGCGACTCTTGCCCTCTTTGCCGCCGTCATATCTCCTCCGGTGACAAAAGGGAGGCGCCTAAAACCGTACAAGTTTAG ATGGCCACTGTCTTGCCTGTAACAGCAACATCAGCTAATTATGCAGCCAGTAACATCATGGACATTGAATCAATGTTCGATCTCGACACCGTCCTCACCGGAGCCGACGACTTCTATTACAACGAAAACGTTGTAGCGCCACCACCCGTGGTGGTCGCCGACTTGCCAACGGTGGCTGTTGAGGACGTATGTGCGGTTTGCATGGAGGATTTCCTGCCGAACGAAGGCGGTAAACAGATCGCCTGCGGGCATGTGTACCATCAATCTTGTATATCCTCTTGGCTCTCCGTCGGCGACTCTTGCCCTCTTTGCCGCCGTCATATCTCCTCCGGTGACAAAAGGGAGGCGCCTAAAACCGTACAAGTTTAG ATGGCCACTGTCTTGCCTGTAACAGCAACATCAGCTAATTATGCAGCCAGTAACATCATGGACATTGAATCAATGTTCGATCTCGACACCGTCCTCACCGGAGCCGACGACTTCTATTACAACGAAAACGTTGTAGCGCCACCACCCGTGGTGGTCGCCGACTTGCCAACGGTGGCTGTTGAGGACGTATGTGCGGTTTGCATGGAGGATTTCCTGCCGAACGAAGGCGGTAAACAGATCGCCTGCGGGCATGTGTACCATCAATCTTGTATATCCTCTTGGCTCTCCGTCGGCGACTCTTGCCCTCTTTGCCGCCGTCATATCTCCTCCGGTGACAAAAGGGAGGCGCCTAAAACCGTACAAGTTTAG MATVLPVTATSANYAASNIMDIESMFDLDTVLTGADDFYYNENVVAPPPVVVADLPTVAVEDVCAVCMEDFLPNEGGKQIACGHVYHQSCISSWLSVGDSCPLCRRHISSGDKREAPKTVQV Homology
BLAST of CmUC11G205880.1 vs. NCBI nr
Match: XP_038877426.1 (E3 ubiquitin-protein ligase RNF126-like [Benincasa hispida]) HSP 1 Score: 203.0 bits (515), Expect = 1.5e-48 Identity = 102/122 (83.61%), Postives = 110/122 (90.16%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. NCBI nr
Match: KAA0061529.1 (RING-H2 finger protein ATL5-like [Cucumis melo var. makuwa]) HSP 1 Score: 202.6 bits (514), Expect = 1.9e-48 Identity = 96/114 (84.21%), Postives = 101/114 (88.60%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. NCBI nr
Match: XP_011650093.1 (E3 ubiquitin-protein ligase RNF115 [Cucumis sativus]) HSP 1 Score: 196.4 bits (498), Expect = 1.4e-46 Identity = 95/115 (82.61%), Postives = 102/115 (88.70%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. NCBI nr
Match: KAE8651508.1 (hypothetical protein Csa_019333 [Cucumis sativus]) HSP 1 Score: 191.0 bits (484), Expect = 5.9e-45 Identity = 92/112 (82.14%), Postives = 99/112 (88.39%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. NCBI nr
Match: XP_023537996.1 (E3 ubiquitin-protein ligase RING1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 176.4 bits (446), Expect = 1.5e-40 Identity = 86/122 (70.49%), Postives = 99/122 (81.15%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. ExPASy Swiss-Prot
Match: Q91YL2 (E3 ubiquitin-protein ligase RNF126 OS=Mus musculus OX=10090 GN=Rnf126 PE=1 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 6.4e-10 Identity = 35/100 (35.00%), Postives = 51/100 (51.00%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. ExPASy Swiss-Prot
Match: Q9Y4L5 (E3 ubiquitin-protein ligase RNF115 OS=Homo sapiens OX=9606 GN=RNF115 PE=1 SV=2) HSP 1 Score: 63.5 bits (153), Expect = 1.8e-09 Identity = 31/85 (36.47%), Postives = 45/85 (52.94%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. ExPASy Swiss-Prot
Match: Q6IRP0 (E3 ubiquitin-protein ligase RNF126-B OS=Xenopus laevis OX=8355 GN=rnf126-b PE=2 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.4e-09 Identity = 32/100 (32.00%), Postives = 50/100 (50.00%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. ExPASy Swiss-Prot
Match: Q9D0C1 (E3 ubiquitin-protein ligase RNF115 OS=Mus musculus OX=10090 GN=Rnf115 PE=1 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.4e-09 Identity = 31/76 (40.79%), Postives = 42/76 (55.26%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. ExPASy Swiss-Prot
Match: Q6DIP3 (E3 ubiquitin-protein ligase RNF126 OS=Xenopus tropicalis OX=8364 GN=rnf126 PE=2 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.4e-09 Identity = 32/100 (32.00%), Postives = 50/100 (50.00%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. ExPASy TrEMBL
Match: A0A5A7V793 (RING-H2 finger protein ATL5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold41G00900 PE=4 SV=1) HSP 1 Score: 202.6 bits (514), Expect = 9.4e-49 Identity = 96/114 (84.21%), Postives = 101/114 (88.60%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. ExPASy TrEMBL
Match: A0A0A0LEZ1 (RING-type domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_2G000920 PE=4 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 6.8e-47 Identity = 95/115 (82.61%), Postives = 102/115 (88.70%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. ExPASy TrEMBL
Match: A0A6J1HNM2 (E3 ubiquitin-protein ligase RNF181-like OS=Cucurbita maxima OX=3661 GN=LOC111465331 PE=4 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 6.1e-40 Identity = 86/123 (69.92%), Postives = 100/123 (81.30%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. ExPASy TrEMBL
Match: A0A6J1FDN7 (E3 ubiquitin-protein ligase RING1-like OS=Cucurbita moschata OX=3662 GN=LOC111444430 PE=4 SV=1) HSP 1 Score: 169.9 bits (429), Expect = 6.8e-39 Identity = 85/123 (69.11%), Postives = 98/123 (79.67%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. ExPASy TrEMBL
Match: A0A6J1G511 (E3 ubiquitin-protein ligase RING1-like OS=Cucurbita moschata OX=3662 GN=LOC111450796 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 6.8e-23 Identity = 66/122 (54.10%), Postives = 83/122 (68.03%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. TAIR 10
Match: AT1G68180.1 (RING/U-box superfamily protein ) HSP 1 Score: 67.8 bits (164), Expect = 7.0e-12 Identity = 31/78 (39.74%), Postives = 46/78 (58.97%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. TAIR 10
Match: AT3G60080.1 (RING/U-box superfamily protein ) HSP 1 Score: 62.8 bits (151), Expect = 2.2e-10 Identity = 23/43 (53.49%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. TAIR 10
Match: AT5G64920.1 (COP1-interacting protein 8 ) HSP 1 Score: 61.2 bits (147), Expect = 6.5e-10 Identity = 23/50 (46.00%), Postives = 31/50 (62.00%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. TAIR 10
Match: AT2G44330.1 (RING/U-box superfamily protein ) HSP 1 Score: 60.8 bits (146), Expect = 8.5e-10 Identity = 21/42 (50.00%), Postives = 29/42 (69.05%), Query Frame = 0
BLAST of CmUC11G205880.1 vs. TAIR 10
Match: AT3G30460.1 (RING/U-box superfamily protein ) HSP 1 Score: 60.8 bits (146), Expect = 8.5e-10 Identity = 22/46 (47.83%), Postives = 32/46 (69.57%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|