
CmUC05G098420.1 (mRNA) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCAGGCGTTTGGGTTTTTCGATCCAACGGCGTGATGCGCCTCGTTGAAAACTCTCAAGCCGGCGACGATTACTCCTCCGACGGTCACCACCATACCGCCGGTGGCGGAAGAAAGAAGGTTCTAGTTCATCTTCCTTCAGGGCAACCGGTTTCTTCCTACGGATTTCTTCAAAAGATTCTAGAAGGTCTGGGATGGGAACGATATTACGAAGGCGATCCAGATTTCTTCCAATTTCACAAGCGATCTTCTATTGATCTCATTTCCCTTCCAATGGACTTCTCCAAATTCAATTCCATTTATATGTACGATCTCGTCATCAAAAACCCTAACGTCTTTCACGTTCGAGAACCCTAA ATGTCAGGCGTTTGGGTTTTTCGATCCAACGGCGTGATGCGCCTCGTTGAAAACTCTCAAGCCGGCGACGATTACTCCTCCGACGGTCACCACCATACCGCCGGTGGCGGAAGAAAGAAGGTTCTAGTTCATCTTCCTTCAGGGCAACCGGTTTCTTCCTACGGATTTCTTCAAAAGATTCTAGAAGGTCTGGGATGGGAACGATATTACGAAGGCGATCCAGATTTCTTCCAATTTCACAAGCGATCTTCTATTGATCTCATTTCCCTTCCAATGGACTTCTCCAAATTCAATTCCATTTATATGTACGATCTCGTCATCAAAAACCCTAACGTCTTTCACGTTCGAGAACCCTAA ATGTCAGGCGTTTGGGTTTTTCGATCCAACGGCGTGATGCGCCTCGTTGAAAACTCTCAAGCCGGCGACGATTACTCCTCCGACGGTCACCACCATACCGCCGGTGGCGGAAGAAAGAAGGTTCTAGTTCATCTTCCTTCAGGGCAACCGGTTTCTTCCTACGGATTTCTTCAAAAGATTCTAGAAGGTCTGGGATGGGAACGATATTACGAAGGCGATCCAGATTTCTTCCAATTTCACAAGCGATCTTCTATTGATCTCATTTCCCTTCCAATGGACTTCTCCAAATTCAATTCCATTTATATGTACGATCTCGTCATCAAAAACCCTAACGTCTTTCACGTTCGAGAACCCTAA MSGVWVFRSNGVMRLVENSQAGDDYSSDGHHHTAGGGRKKVLVHLPSGQPVSSYGFLQKILEGLGWERYYEGDPDFFQFHKRSSIDLISLPMDFSKFNSIYMYDLVIKNPNVFHVREP Homology
BLAST of CmUC05G098420.1 vs. NCBI nr
Match: XP_038899381.1 (flowering-promoting factor 1-like protein 2 [Benincasa hispida]) HSP 1 Score: 237.3 bits (604), Expect = 6.9e-59 Identity = 114/121 (94.21%), Postives = 115/121 (95.04%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. NCBI nr
Match: XP_004136318.1 (flowering-promoting factor 1-like protein 2 [Cucumis sativus] >KGN60157.1 hypothetical protein Csa_002053 [Cucumis sativus]) HSP 1 Score: 236.5 bits (602), Expect = 1.2e-58 Identity = 114/123 (92.68%), Postives = 115/123 (93.50%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. NCBI nr
Match: XP_022976219.1 (flowering-promoting factor 1-like protein 2 [Cucurbita maxima]) HSP 1 Score: 235.0 bits (598), Expect = 3.4e-58 Identity = 111/119 (93.28%), Postives = 115/119 (96.64%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. NCBI nr
Match: XP_022937028.1 (flowering-promoting factor 1-like protein 2 [Cucurbita moschata]) HSP 1 Score: 234.2 bits (596), Expect = 5.8e-58 Identity = 111/121 (91.74%), Postives = 115/121 (95.04%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. NCBI nr
Match: XP_023536365.1 (flowering-promoting factor 1-like protein 2 [Cucurbita pepo subsp. pepo] >KAG6591620.1 Flowering-promoting factor 1-like protein 2, partial [Cucurbita argyrosperma subsp. sororia] >KAG7024503.1 Flowering-promoting factor 1-like protein 2, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 233.8 bits (595), Expect = 7.6e-58 Identity = 111/122 (90.98%), Postives = 115/122 (94.26%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. ExPASy Swiss-Prot
Match: Q5Q0B3 (Flowering-promoting factor 1-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FLP1 PE=2 SV=2) HSP 1 Score: 156.4 bits (394), Expect = 2.0e-37 Identity = 82/127 (64.57%), Postives = 94/127 (74.02%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. ExPASy Swiss-Prot
Match: Q9LXB5 (Flowering-promoting factor 1-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=FLP2 PE=2 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 1.7e-36 Identity = 74/117 (63.25%), Postives = 89/117 (76.07%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. ExPASy Swiss-Prot
Match: O23624 (Flowering-promoting factor 1 OS=Arabidopsis thaliana OX=3702 GN=FPF1 PE=1 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 1.6e-34 Identity = 74/119 (62.18%), Postives = 93/119 (78.15%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. ExPASy Swiss-Prot
Match: O24340 (Flowering-promoting factor 1 OS=Sinapis alba OX=3728 GN=FPF1 PE=2 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 6.1e-34 Identity = 73/119 (61.34%), Postives = 93/119 (78.15%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. ExPASy Swiss-Prot
Match: Q9LGE3 (Flowering-promoting factor 1-like protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=RAA1 PE=1 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 4.1e-30 Identity = 72/119 (60.50%), Postives = 83/119 (69.75%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. ExPASy TrEMBL
Match: A0A0A0LHE6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G881700 PE=3 SV=1) HSP 1 Score: 236.5 bits (602), Expect = 5.7e-59 Identity = 114/123 (92.68%), Postives = 115/123 (93.50%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. ExPASy TrEMBL
Match: A0A6J1IMX4 (flowering-promoting factor 1-like protein 2 OS=Cucurbita maxima OX=3661 GN=LOC111476674 PE=3 SV=1) HSP 1 Score: 235.0 bits (598), Expect = 1.7e-58 Identity = 111/119 (93.28%), Postives = 115/119 (96.64%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. ExPASy TrEMBL
Match: A0A6J1FEW7 (flowering-promoting factor 1-like protein 2 OS=Cucurbita moschata OX=3662 GN=LOC111443448 PE=3 SV=1) HSP 1 Score: 234.2 bits (596), Expect = 2.8e-58 Identity = 111/121 (91.74%), Postives = 115/121 (95.04%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. ExPASy TrEMBL
Match: A0A5A7UF14 (Flowering-promoting factor 1-like protein 2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold64983G00010 PE=3 SV=1) HSP 1 Score: 232.3 bits (591), Expect = 1.1e-57 Identity = 113/129 (87.60%), Postives = 114/129 (88.37%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. ExPASy TrEMBL
Match: A0A1S3CSB1 (flowering-promoting factor 1-like protein 2 OS=Cucumis melo OX=3656 GN=LOC103503767 PE=3 SV=1) HSP 1 Score: 232.3 bits (591), Expect = 1.1e-57 Identity = 113/129 (87.60%), Postives = 114/129 (88.37%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. TAIR 10
Match: AT4G31380.1 (FPF1-like protein 1 ) HSP 1 Score: 156.4 bits (394), Expect = 1.4e-38 Identity = 82/127 (64.57%), Postives = 94/127 (74.02%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. TAIR 10
Match: AT5G10625.1 (BEST Arabidopsis thaliana protein match is: flowering promoting factor 1 (TAIR:AT5G24860.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 153.3 bits (386), Expect = 1.2e-37 Identity = 74/117 (63.25%), Postives = 89/117 (76.07%), Query Frame = 0
BLAST of CmUC05G098420.1 vs. TAIR 10
Match: AT5G24860.1 (flowering promoting factor 1 ) HSP 1 Score: 146.7 bits (369), Expect = 1.1e-35 Identity = 74/119 (62.18%), Postives = 93/119 (78.15%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|