Cla97C11G214193.1 (mRNA) Watermelon (97103) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGATGATGTCCACTCCTGGCTCGATGCACTTAACGAAAGGGAACTCTCACGATGAAGAAAGAATTTCCTTCGTAATTAAGCAGCATCCTTTAAGTAGGGGTGCGCCGGACCGCCGACGAATAATAGGTACCCCCACCCCAGGCAGAGTTAGTGAGCCGTGTAATAGGCGACCATTTCGCGCGGTTCGGGGGGCACTTGAGTCAGCCGCCGGCGCCCGACTGCGTCTTGACCCCTATCCAATTTTTGGGCCAGAATTTTGGGTGTAGTTAATACTCCCATCCCAAATAAAAGGGGAATTGGTCTATGGTCGATTCAGTAATAAATAGGAATTTTTCGTTCTACCTCGTGAAAAAAAAAAACTTATTTCTTTTGTGTAATTAACCATTCCTTTTTCTTTCAGAAAGAAATGAAATTATGTTCAAAGAAGCAAATATGTCATGGTTAAAGGAGTCTATCCATCGAGGGCATCCCGAAAACGTCCGGGTCGAAATATGGCTTTCAAATTAAGTTTTGAATTAGTGGATGCTGCCAAAGGGAGTGGCGATGCCATACGTAAAAAGGAAGAGACTCATAGAATGGCAGAGGCAAATAGAGCTTTTGCACATTTTCGTTAA ATGATGATGATGTCCACTCCTGGCTCGATGCACTTAACGAAAGGGAACTCTCACGATGAAGAAAGAATTTCCTTCGTAATTAAGCAGCATCCTTTAAGTAGGGGTGCGCCGGACCGCCGACGAATAATAGGAGTCTATCCATCGAGGGCATCCCGAAAACGTCCGGGTCGAAATATGGCTTTCAAATTAAGTTTTGAATTAGTGGATGCTGCCAAAGGGAGTGGCGATGCCATACGTAAAAAGGAAGAGACTCATAGAATGGCAGAGGCAAATAGAGCTTTTGCACATTTTCGTTAA ATGATGATGATGTCCACTCCTGGCTCGATGCACTTAACGAAAGGGAACTCTCACGATGAAGAAAGAATTTCCTTCGTAATTAAGCAGCATCCTTTAAGTAGGGGTGCGCCGGACCGCCGACGAATAATAGGAGTCTATCCATCGAGGGCATCCCGAAAACGTCCGGGTCGAAATATGGCTTTCAAATTAAGTTTTGAATTAGTGGATGCTGCCAAAGGGAGTGGCGATGCCATACGTAAAAAGGAAGAGACTCATAGAATGGCAGAGGCAAATAGAGCTTTTGCACATTTTCGTTAA MMMMSTPGSMHLTKGNSHDEERISFVIKQHPLSRGAPDRRRIIGVYPSRASRKRPGRNMAFKLSFELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Homology
BLAST of Cla97C11G214193.1 vs. NCBI nr
Match: YP_009343151.1 (30S ribosomal protein S7 [Paris cronquistii] >YP_009343164.1 30S ribosomal protein S7 [Paris cronquistii] >YP_009343233.1 30S ribosomal protein S7 [Paris dunniana] >YP_009343246.1 30S ribosomal protein S7 [Paris dunniana] >YP_009343317.1 30S ribosomal protein S7 [Paris fargesii] >YP_009343330.1 30S ribosomal protein S7 [Paris fargesii] >YP_009343403.1 30S ribosomal protein S7 [Paris luquanensis] >YP_009343416.1 30S ribosomal protein S7 [Paris luquanensis] >YP_009343487.1 30S ribosomal protein S7 [Paris mairei] >YP_009343500.1 30S ribosomal protein S7 [Paris mairei] >YP_009343571.1 30S ribosomal protein S7 [Paris marmorata] >YP_009343584.1 30S ribosomal protein S7 [Paris marmorata] >YP_009343655.1 30S ribosomal protein S7 [Paris polyphylla var. chinensis] >YP_009343668.1 30S ribosomal protein S7 [Paris polyphylla var. chinensis] >YP_009343739.1 30S ribosomal protein S7 [Paris polyphylla var. yunnanensis] >YP_009343752.1 30S ribosomal protein S7 [Paris polyphylla var. yunnanensis] >YP_009343823.1 30S ribosomal protein S7 [Paris vietnamensis] >YP_009343836.1 30S ribosomal protein S7 [Paris vietnamensis] >YP_009733963.1 30S ribosomal protein S7 [Paris birmanica] >YP_009733976.1 30S ribosomal protein S7 [Paris birmanica] >YP_009734049.1 30S ribosomal protein S7 [Paris qiliangiana] >YP_009734062.1 30S ribosomal protein S7 [Paris qiliangiana] >YP_009734135.1 30S ribosomal protein S7 [Paris yanchii] >YP_009734148.1 30S ribosomal protein S7 [Paris yanchii] >YP_009734307.1 30S ribosomal protein S7 [Paris xichouensis] >YP_009734320.1 30S ribosomal protein S7 [Paris xichouensis] >YP_009736921.1 30S ribosomal protein S7 [Paris daliensis] >YP_009736934.1 30S ribosomal protein S7 [Paris daliensis] >YP_009737093.1 30S ribosomal protein S7 [Paris delavayi] >YP_009737106.1 30S ribosomal protein S7 [Paris delavayi] >YP_009737179.1 30S ribosomal protein S7 [Paris undulata] >YP_009737192.1 30S ribosomal protein S7 [Paris undulata] >YP_009737265.1 30S ribosomal protein S7 [Paris polyphylla] >YP_009737278.1 30S ribosomal protein S7 [Paris polyphylla] >YP_009737437.1 30S ribosomal protein S7 [Paris caobangensis] >YP_009737450.1 30S ribosomal protein S7 [Paris caobangensis] >YP_009912773.1 ribosomal protein S7 [Paris polyphylla var. emeiensis] >YP_009912788.1 ribosomal protein S7 [Paris polyphylla var. emeiensis] >YP_009995612.1 ribosomal protein S7 [Paris liiana] >YP_009995627.1 ribosomal protein S7 [Paris liiana] >QHV40678.1 30S ribosomal protein S7 [Paris polyphylla var. stenophylla] >QJT43086.1 ribosomal protein S7 [Paris stigmatosa] >QVD39715.1 ribosomal protein S7 [Paris polyphylla var. alba] >QYF10246.1 ribosomal protein S7 [Paris caojianensis] >AND76606.1 ribosomal protein S7 [Paris polyphylla var. yunnanensis]) HSP 1 Score: 99.8 bits (247), Expect = 1.4e-17 Identity = 54/77 (70.13%), Postives = 60/77 (77.92%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. NCBI nr
Match: XP_033511663.1 (30S ribosomal protein S7, chloroplastic-like [Nicotiana tomentosiformis]) HSP 1 Score: 98.2 bits (243), Expect = 4.2e-17 Identity = 53/77 (68.83%), Postives = 59/77 (76.62%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. NCBI nr
Match: QSJ48861.1 (ribosomal protein S7 [Medicago arabica]) HSP 1 Score: 98.2 bits (243), Expect = 4.2e-17 Identity = 53/77 (68.83%), Postives = 60/77 (77.92%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. NCBI nr
Match: YP_009935315.1 (ribosomal protein S7 [Edgeworthia chrysantha] >YP_009935338.1 ribosomal protein S7 [Edgeworthia chrysantha] >QST15444.1 ribosomal protein S7 [Edgeworthia gardneri] >QNS25578.1 ribosomal protein S7 [Edgeworthia chrysantha] >QNS25601.1 ribosomal protein S7 [Edgeworthia chrysantha] >QRG01222.1 ribosomal protein S7 [Edgeworthia chrysantha] >QRG01223.1 ribosomal protein S7 [Edgeworthia chrysantha]) HSP 1 Score: 97.8 bits (242), Expect = 5.4e-17 Identity = 53/77 (68.83%), Postives = 60/77 (77.92%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. NCBI nr
Match: QOW06966.1 (ribosomal protein S7 [Daphne genkwa]) HSP 1 Score: 97.8 bits (242), Expect = 5.4e-17 Identity = 53/77 (68.83%), Postives = 60/77 (77.92%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. ExPASy Swiss-Prot
Match: A6MMG8 (30S ribosomal protein S7, chloroplastic OS=Chloranthus spicatus OX=13006 GN=rps7-A PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.7e-19 Identity = 53/77 (68.83%), Postives = 58/77 (75.32%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. ExPASy Swiss-Prot
Match: B2LMN9 (30S ribosomal protein S7, chloroplastic OS=Guizotia abyssinica OX=4230 GN=rps7-A PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.7e-19 Identity = 53/87 (60.92%), Postives = 62/87 (71.26%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. ExPASy Swiss-Prot
Match: Q1KXP8 (30S ribosomal protein S7, chloroplastic OS=Helianthus annuus OX=4232 GN=rps7-A PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.7e-19 Identity = 53/87 (60.92%), Postives = 62/87 (71.26%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. ExPASy Swiss-Prot
Match: P62729 (30S ribosomal protein S7, chloroplastic OS=Atropa belladonna OX=33113 GN=rps7-A PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 3.5e-19 Identity = 52/77 (67.53%), Postives = 58/77 (75.32%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. ExPASy Swiss-Prot
Match: Q09MB7 (30S ribosomal protein S7, chloroplastic OS=Citrus sinensis OX=2711 GN=rps7-A PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 3.5e-19 Identity = 52/77 (67.53%), Postives = 58/77 (75.32%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. ExPASy TrEMBL
Match: A0A6C0MS16 (30S ribosomal protein S7, chloroplastic OS=Paris delavayi OX=374957 GN=rps7 PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 6.9e-18 Identity = 54/77 (70.13%), Postives = 60/77 (77.92%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. ExPASy TrEMBL
Match: A0A1L6V2B8 (30S ribosomal protein S7, chloroplastic OS=Paris marmorata OX=221257 GN=rps7 PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 6.9e-18 Identity = 54/77 (70.13%), Postives = 60/77 (77.92%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. ExPASy TrEMBL
Match: A0A6M5AA45 (30S ribosomal protein S7, chloroplastic OS=Paris stigmatosa OX=2735601 GN=rps7 PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 6.9e-18 Identity = 54/77 (70.13%), Postives = 60/77 (77.92%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. ExPASy TrEMBL
Match: A0A1L6V101 (30S ribosomal protein S7, chloroplastic OS=Paris dunniana OX=374961 GN=rps7 PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 6.9e-18 Identity = 54/77 (70.13%), Postives = 60/77 (77.92%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. ExPASy TrEMBL
Match: A0A6C0MTQ0 (30S ribosomal protein S7, chloroplastic OS=Paris xichouensis OX=2594874 GN=rps7 PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 6.9e-18 Identity = 54/77 (70.13%), Postives = 60/77 (77.92%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. TAIR 10
Match: ATCG01240.1 (ribosomal protein S7 ) HSP 1 Score: 95.1 bits (235), Expect = 3.3e-20 Identity = 52/77 (67.53%), Postives = 58/77 (75.32%), Query Frame = 0
BLAST of Cla97C11G214193.1 vs. TAIR 10
Match: ATCG00900.1 (Ribosomal protein S7p/S5e family protein ) HSP 1 Score: 95.1 bits (235), Expect = 3.3e-20 Identity = 52/77 (67.53%), Postives = 58/77 (75.32%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (97103) v2.5
Date Performed: 2022-01-31
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|