
Cla97C10G199785.1 (mRNA) Watermelon (97103) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGGTTGGCATACCCAATGTTAGTGGTCTATCGACCGAGCAACGTAAACAGTTAACCATTGTTGTAGAGCTTGTTTCCAATCCTTCTATCATCTTAATGGATGAGCCTACCACTGGTTTGGATGCAAGAGCAGCTGCCATTGTCATGCGAGCGGTTAAGAATGTGGTTGATACTGGAAAAACAGTAGTTTGTACCATCCACCAGCCAAGTATCGACATCTTTGAATCGTTTGATGTGGTAAAAATCTTTCAAATGCTTTAATGCTCAATTTTATCCCCCCTCTAGTCTTCTCACCGTTTTGTGCAGTTGATTCTTGATGATCTACTATGGACTGCTCAGACGAAAAAGGTTATAGAATATTTTGAGGTCACTCTGCTTTAA ATGTTGGTTGGCATACCCAATGTTAGTGGTCTATCGACCGAGCAACGTAAACAGTTAACCATTGTTGTAGAGCTTGTTTCCAATCCTTCTATCATCTTAATGGATGAGCCTACCACTGGTTTGGATGCAAGAGCAGCTGCCATTGTCATGCGAGCGGTTAAGAATGTGGTTGATACTGGAAAAACAGTAGTTTGTACCATCCACCAGCCAAGTATCGACATCTTTGAATCGTTTGATGTGTTGATTCTTGATGATCTACTATGGACTGCTCAGACGAAAAAGGTTATAGAATATTTTGAGGTCACTCTGCTTTAA ATGTTGGTTGGCATACCCAATGTTAGTGGTCTATCGACCGAGCAACGTAAACAGTTAACCATTGTTGTAGAGCTTGTTTCCAATCCTTCTATCATCTTAATGGATGAGCCTACCACTGGTTTGGATGCAAGAGCAGCTGCCATTGTCATGCGAGCGGTTAAGAATGTGGTTGATACTGGAAAAACAGTAGTTTGTACCATCCACCAGCCAAGTATCGACATCTTTGAATCGTTTGATGTGTTGATTCTTGATGATCTACTATGGACTGCTCAGACGAAAAAGGTTATAGAATATTTTGAGGTCACTCTGCTTTAA MLVGIPNVSGLSTEQRKQLTIVVELVSNPSIILMDEPTTGLDARAAAIVMRAVKNVVDTGKTVVCTIHQPSIDIFESFDVLILDDLLWTAQTKKVIEYFEVTLL Homology
BLAST of Cla97C10G199785.1 vs. NCBI nr
Match: XP_011652141.2 (pleiotropic drug resistance protein 3 [Cucumis sativus] >KGN59512.2 hypothetical protein Csa_002232 [Cucumis sativus]) HSP 1 Score: 149.4 bits (376), Expect = 1.7e-32 Identity = 82/108 (75.93%), Postives = 91/108 (84.26%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. NCBI nr
Match: XP_008443151.1 (PREDICTED: pleiotropic drug resistance protein 3-like isoform X2 [Cucumis melo]) HSP 1 Score: 149.4 bits (376), Expect = 1.7e-32 Identity = 82/108 (75.93%), Postives = 91/108 (84.26%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. NCBI nr
Match: XP_008443150.1 (PREDICTED: pleiotropic drug resistance protein 3-like isoform X1 [Cucumis melo]) HSP 1 Score: 149.4 bits (376), Expect = 1.7e-32 Identity = 82/108 (75.93%), Postives = 91/108 (84.26%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. NCBI nr
Match: KAA0053948.1 (pleiotropic drug resistance protein 3-like isoform X1 [Cucumis melo var. makuwa] >TYK25456.1 pleiotropic drug resistance protein 3-like isoform X1 [Cucumis melo var. makuwa]) HSP 1 Score: 149.4 bits (376), Expect = 1.7e-32 Identity = 82/108 (75.93%), Postives = 91/108 (84.26%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. NCBI nr
Match: XP_031741892.1 (pleiotropic drug resistance protein 3 isoform X2 [Cucumis sativus]) HSP 1 Score: 149.1 bits (375), Expect = 2.2e-32 Identity = 82/107 (76.64%), Postives = 89/107 (83.18%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. ExPASy Swiss-Prot
Match: Q5W274 (Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum OX=4097 GN=PDR3 PE=2 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 2.7e-33 Identity = 78/108 (72.22%), Postives = 88/108 (81.48%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. ExPASy Swiss-Prot
Match: Q9LFH0 (ABC transporter G family member 37 OS=Arabidopsis thaliana OX=3702 GN=ABCG37 PE=1 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 6.0e-33 Identity = 75/107 (70.09%), Postives = 88/107 (82.24%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. ExPASy Swiss-Prot
Match: Q7PC83 (ABC transporter G family member 41 OS=Arabidopsis thaliana OX=3702 GN=ABCG41 PE=2 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 7.8e-33 Identity = 76/107 (71.03%), Postives = 88/107 (82.24%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. ExPASy Swiss-Prot
Match: Q5Z9S8 (ABC transporter G family member 42 OS=Oryza sativa subsp. japonica OX=39947 GN=ABCG42 PE=2 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 1.3e-32 Identity = 73/107 (68.22%), Postives = 90/107 (84.11%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. ExPASy Swiss-Prot
Match: Q8GZ52 (ABC transporter G family member 30 OS=Arabidopsis thaliana OX=3702 GN=ABCG30 PE=1 SV=2) HSP 1 Score: 139.8 bits (351), Expect = 1.7e-32 Identity = 76/107 (71.03%), Postives = 87/107 (81.31%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. ExPASy TrEMBL
Match: A0A5A7UFY6 (Pleiotropic drug resistance protein 3-like isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold352G006020 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 8.1e-33 Identity = 82/108 (75.93%), Postives = 91/108 (84.26%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. ExPASy TrEMBL
Match: A0A0A0LBH1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G814320 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 8.1e-33 Identity = 82/108 (75.93%), Postives = 91/108 (84.26%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. ExPASy TrEMBL
Match: A0A1S3B6X0 (pleiotropic drug resistance protein 3-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103486825 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 8.1e-33 Identity = 82/108 (75.93%), Postives = 91/108 (84.26%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. ExPASy TrEMBL
Match: A0A1S3B7C4 (pleiotropic drug resistance protein 3-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103486825 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 8.1e-33 Identity = 82/108 (75.93%), Postives = 91/108 (84.26%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. ExPASy TrEMBL
Match: A0A0A0KPP7 (ABC transporter domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_5G292210 PE=4 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 1.1e-32 Identity = 82/107 (76.64%), Postives = 89/107 (83.18%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. TAIR 10
Match: AT3G53480.1 (pleiotropic drug resistance 9 ) HSP 1 Score: 141.4 bits (355), Expect = 4.2e-34 Identity = 75/107 (70.09%), Postives = 88/107 (82.24%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. TAIR 10
Match: AT4G15215.1 (pleiotropic drug resistance 13 ) HSP 1 Score: 141.0 bits (354), Expect = 5.5e-34 Identity = 76/107 (71.03%), Postives = 88/107 (82.24%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. TAIR 10
Match: AT4G15230.1 (pleiotropic drug resistance 2 ) HSP 1 Score: 139.8 bits (351), Expect = 1.2e-33 Identity = 76/107 (71.03%), Postives = 87/107 (81.31%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. TAIR 10
Match: AT4G15233.1 (ABC-2 and Plant PDR ABC-type transporter family protein ) HSP 1 Score: 139.8 bits (351), Expect = 1.2e-33 Identity = 75/106 (70.75%), Postives = 87/106 (82.08%), Query Frame = 0
BLAST of Cla97C10G199785.1 vs. TAIR 10
Match: AT4G15233.2 (ABC-2 and Plant PDR ABC-type transporter family protein ) HSP 1 Score: 139.8 bits (351), Expect = 1.2e-33 Identity = 75/106 (70.75%), Postives = 87/106 (82.08%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (97103) v2.5
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|