Cla97C06G125410.1 (mRNA) Watermelon (97103) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGCCCCAACGAGATCGGAGGCCCTTTCGCTTCTTCGCTCTCTGCTCCGTACAGCTCGTCACTTCTGCGATTACAACATCAGAGAGTACACCAAACGACGCGCCCTCGACGGCTTCCGCCATAACCGGAACCTTTCCGATCCTCCATCCATCTCCTCCGCCTACGCCGACGGCAAGGCTCAGCTTGAAGTTGCTAAAAGACAATCCGCTGTCTACTCCCTCTATGCGCCCAAGGTAAAGAGCATCATGGAGGCTCATCGCACAAACTGA ATGGCGGCCCCAACGAGATCGGAGGCCCTTTCGCTTCTTCGCTCTCTGCTCCGTACAGCTCGTCACTTCTGCGATTACAACATCAGAGAGTACACCAAACGACGCGCCCTCGACGGCTTCCGCCATAACCGGAACCTTTCCGATCCTCCATCCATCTCCTCCGCCTACGCCGACGGCAAGGCTCAGCTTGAAGTTGCTAAAAGACAATCCGCTGTCTACTCCCTCTATGCGCCCAAGGTAAAGAGCATCATGGAGGCTCATCGCACAAACTGA ATGGCGGCCCCAACGAGATCGGAGGCCCTTTCGCTTCTTCGCTCTCTGCTCCGTACAGCTCGTCACTTCTGCGATTACAACATCAGAGAGTACACCAAACGACGCGCCCTCGACGGCTTCCGCCATAACCGGAACCTTTCCGATCCTCCATCCATCTCCTCCGCCTACGCCGACGGCAAGGCTCAGCTTGAAGTTGCTAAAAGACAATCCGCTGTCTACTCCCTCTATGCGCCCAAGGTAAAGAGCATCATGGAGGCTCATCGCACAAACTGA MAAPTRSEALSLLRSLLRTARHFCDYNIREYTKRRALDGFRHNRNLSDPPSISSAYADGKAQLEVAKRQSAVYSLYAPKVKSIMEAHRTN Homology
BLAST of Cla97C06G125410.1 vs. NCBI nr
Match: XP_038879775.1 (LYR motif-containing protein 4-like [Benincasa hispida]) HSP 1 Score: 168.3 bits (425), Expect = 3.0e-38 Identity = 85/90 (94.44%), Postives = 86/90 (95.56%), Query Frame = 0
BLAST of Cla97C06G125410.1 vs. NCBI nr
Match: XP_011660289.1 (LYR motif-containing protein 4 [Cucumis sativus]) HSP 1 Score: 163.7 bits (413), Expect = 7.4e-37 Identity = 83/90 (92.22%), Postives = 86/90 (95.56%), Query Frame = 0
BLAST of Cla97C06G125410.1 vs. NCBI nr
Match: XP_008453246.1 (PREDICTED: LYR motif-containing protein 4 [Cucumis melo] >KAA0057977.1 LYR motif-containing protein 4 [Cucumis melo var. makuwa]) HSP 1 Score: 161.0 bits (406), Expect = 4.8e-36 Identity = 81/90 (90.00%), Postives = 85/90 (94.44%), Query Frame = 0
BLAST of Cla97C06G125410.1 vs. NCBI nr
Match: XP_022932898.1 (LYR motif-containing protein 4 [Cucurbita moschata] >XP_022973088.1 LYR motif-containing protein 4 [Cucurbita maxima] >XP_023531294.1 LYR motif-containing protein 4 [Cucurbita pepo subsp. pepo] >KAG7021536.1 LYR motif-containing protein 4, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 156.8 bits (395), Expect = 9.0e-35 Identity = 79/90 (87.78%), Postives = 83/90 (92.22%), Query Frame = 0
BLAST of Cla97C06G125410.1 vs. NCBI nr
Match: XP_022134602.1 (LYR motif-containing protein 4-like [Momordica charantia]) HSP 1 Score: 152.5 bits (384), Expect = 1.7e-33 Identity = 75/90 (83.33%), Postives = 82/90 (91.11%), Query Frame = 0
BLAST of Cla97C06G125410.1 vs. ExPASy Swiss-Prot
Match: Q8K215 (LYR motif-containing protein 4 OS=Mus musculus OX=10090 GN=Lyrm4 PE=1 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.4e-09 Identity = 31/77 (40.26%), Postives = 46/77 (59.74%), Query Frame = 0
BLAST of Cla97C06G125410.1 vs. ExPASy Swiss-Prot
Match: Q6Q560 (Protein ISD11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISD11 PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.8e-07 Identity = 28/74 (37.84%), Postives = 40/74 (54.05%), Query Frame = 0
BLAST of Cla97C06G125410.1 vs. ExPASy Swiss-Prot
Match: B8JLQ0 (LYR motif-containing protein 4 OS=Danio rerio OX=7955 GN=lyrm4 PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.8e-06 Identity = 27/77 (35.06%), Postives = 45/77 (58.44%), Query Frame = 0
BLAST of Cla97C06G125410.1 vs. ExPASy Swiss-Prot
Match: Q6DCS1 (LYR motif-containing protein 4 OS=Xenopus laevis OX=8355 GN=lyrm4 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.4e-06 Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = 0
BLAST of Cla97C06G125410.1 vs. ExPASy Swiss-Prot
Match: O46098 (Protein bcn92 OS=Drosophila melanogaster OX=7227 GN=bcn92 PE=1 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 7.0e-06 Identity = 31/85 (36.47%), Postives = 47/85 (55.29%), Query Frame = 0
BLAST of Cla97C06G125410.1 vs. ExPASy TrEMBL
Match: A0A0A0LPH2 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G012090 PE=4 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 3.6e-37 Identity = 83/90 (92.22%), Postives = 86/90 (95.56%), Query Frame = 0
BLAST of Cla97C06G125410.1 vs. ExPASy TrEMBL
Match: A0A5A7UTC8 (LYR motif-containing protein 4 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold274G002810 PE=4 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 2.3e-36 Identity = 81/90 (90.00%), Postives = 85/90 (94.44%), Query Frame = 0
BLAST of Cla97C06G125410.1 vs. ExPASy TrEMBL
Match: A0A1S3BV74 (LYR motif-containing protein 4 OS=Cucumis melo OX=3656 GN=LOC103494022 PE=4 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 2.3e-36 Identity = 81/90 (90.00%), Postives = 85/90 (94.44%), Query Frame = 0
BLAST of Cla97C06G125410.1 vs. ExPASy TrEMBL
Match: A0A6J1IC29 (LYR motif-containing protein 4 OS=Cucurbita maxima OX=3661 GN=LOC111471615 PE=4 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 4.4e-35 Identity = 79/90 (87.78%), Postives = 83/90 (92.22%), Query Frame = 0
BLAST of Cla97C06G125410.1 vs. ExPASy TrEMBL
Match: A0A6J1F322 (LYR motif-containing protein 4 OS=Cucurbita moschata OX=3662 GN=LOC111439443 PE=4 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 4.4e-35 Identity = 79/90 (87.78%), Postives = 83/90 (92.22%), Query Frame = 0
BLAST of Cla97C06G125410.1 vs. TAIR 10
Match: AT5G61220.1 (LYR family of Fe/S cluster biogenesis protein ) HSP 1 Score: 95.9 bits (237), Expect = 1.8e-20 Identity = 49/79 (62.03%), Postives = 58/79 (73.42%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (97103) v2.5
Date Performed: 2022-01-31
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|