
Cla97C01G011280.1 (mRNA) Watermelon (97103) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTCAAAGCTTCAACAATCTAAATTCAGAATCGATATCGCAAGATCTGTCGTTAGCTATATCTAACTCGACAATTGAAGATGCCACGACGGTGGCCATGGTGCTACTAGGATGCACTCGATGCCTCATGTACGTCATGTCGTCTAAGTTAGATCTCAAGTGTCCTAAATGTAACGGCACTACATTGCTTGATGTATTCAATTTGGTCAATCAAGCATCTCGAAAAAATGTTGTCGACATGCCGCCCGATGTTGCTAAATGA ATGGGTCAAAGCTTCAACAATCTAAATTCAGAATCGATATCGCAAGATCTGTCGTTAGCTATATCTAACTCGACAATTGAAGATGCCACGACGGTGGCCATGGTGCTACTAGGATGCACTCGATGCCTCATGTACGTCATGTCGTCTAAGTTAGATCTCAAGTGTCCTAAATGTAACGGCACTACATTGCTTGATGTATTCAATTTGGTCAATCAAGCATCTCGAAAAAATGTTGTCGACATGCCGCCCGATGTTGCTAAATGA ATGGGTCAAAGCTTCAACAATCTAAATTCAGAATCGATATCGCAAGATCTGTCGTTAGCTATATCTAACTCGACAATTGAAGATGCCACGACGGTGGCCATGGTGCTACTAGGATGCACTCGATGCCTCATGTACGTCATGTCGTCTAAGTTAGATCTCAAGTGTCCTAAATGTAACGGCACTACATTGCTTGATGTATTCAATTTGGTCAATCAAGCATCTCGAAAAAATGTTGTCGACATGCCGCCCGATGTTGCTAAATGA MGQSFNNLNSESISQDLSLAISNSTIEDATTVAMVLLGCTRCLMYVMSSKLDLKCPKCNGTTLLDVFNLVNQASRKNVVDMPPDVAK Homology
BLAST of Cla97C01G011280.1 vs. NCBI nr
Match: KAG6583700.1 (hypothetical protein SDJN03_19632, partial [Cucurbita argyrosperma subsp. sororia] >KAG7019351.1 hypothetical protein SDJN02_18311 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 104.8 bits (260), Expect = 3.9e-19 Identity = 52/66 (78.79%), Postives = 56/66 (84.85%), Query Frame = 0
BLAST of Cla97C01G011280.1 vs. NCBI nr
Match: XP_039002217.1 (uncharacterized protein LOC120128632 [Hibiscus syriacus] >KAE8702514.1 hypothetical protein F3Y22_tig00110482pilonHSYRG00220 [Hibiscus syriacus]) HSP 1 Score: 60.1 bits (144), Expect = 1.1e-05 Identity = 29/53 (54.72%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of Cla97C01G011280.1 vs. NCBI nr
Match: XP_022888450.1 (uncharacterized protein LOC111403986 [Olea europaea var. sylvestris]) HSP 1 Score: 60.1 bits (144), Expect = 1.1e-05 Identity = 35/67 (52.24%), Postives = 45/67 (67.16%), Query Frame = 0
BLAST of Cla97C01G011280.1 vs. NCBI nr
Match: KAB2028179.1 (hypothetical protein ES319_D05G081300v1 [Gossypium barbadense] >KAG4145173.1 hypothetical protein ERO13_D05G081700v2 [Gossypium hirsutum] >TYG67562.1 hypothetical protein ES288_D05G085700v1 [Gossypium darwinii] >TYH69965.1 hypothetical protein ES332_D05G087100v1 [Gossypium tomentosum] >TYI80405.1 hypothetical protein E1A91_D05G085600v1 [Gossypium mustelinum]) HSP 1 Score: 59.7 bits (143), Expect = 1.5e-05 Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 0
BLAST of Cla97C01G011280.1 vs. NCBI nr
Match: XP_004506211.1 (uncharacterized protein LOC101502581 [Cicer arietinum]) HSP 1 Score: 59.3 bits (142), Expect = 1.9e-05 Identity = 27/49 (55.10%), Postives = 33/49 (67.35%), Query Frame = 0
BLAST of Cla97C01G011280.1 vs. ExPASy Swiss-Prot
Match: Q9FNI1 (Protein GL2-INTERACTING REPRESSOR 1 OS=Arabidopsis thaliana OX=3702 GN=GIR1 PE=1 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 3.0e-06 Identity = 24/35 (68.57%), Postives = 27/35 (77.14%), Query Frame = 0
BLAST of Cla97C01G011280.1 vs. ExPASy Swiss-Prot
Match: Q9SRN4 (Protein GL2-INTERACTING REPRESSOR 2 OS=Arabidopsis thaliana OX=3702 GN=GIR2 PE=1 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 1.2e-05 Identity = 31/63 (49.21%), Postives = 38/63 (60.32%), Query Frame = 0
BLAST of Cla97C01G011280.1 vs. ExPASy TrEMBL
Match: A0A6A3AD94 (Uncharacterized protein OS=Hibiscus syriacus OX=106335 GN=F3Y22_tig00110482pilonHSYRG00220 PE=4 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 5.4e-06 Identity = 29/53 (54.72%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of Cla97C01G011280.1 vs. ExPASy TrEMBL
Match: A0A5D2KTB2 (Uncharacterized protein OS=Gossypium tomentosum OX=34277 GN=ES332_D05G087100v1 PE=4 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 7.0e-06 Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 0
BLAST of Cla97C01G011280.1 vs. ExPASy TrEMBL
Match: A0A5J5REV4 (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=ES319_D05G081300v1 PE=4 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 7.0e-06 Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 0
BLAST of Cla97C01G011280.1 vs. ExPASy TrEMBL
Match: A0A5D2CHE2 (Uncharacterized protein OS=Gossypium darwinii OX=34276 GN=ES288_D05G085700v1 PE=4 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 7.0e-06 Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 0
BLAST of Cla97C01G011280.1 vs. ExPASy TrEMBL
Match: A0A5D2UUA0 (Uncharacterized protein OS=Gossypium mustelinum OX=34275 GN=E1A91_D05G085600v1 PE=4 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 7.0e-06 Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 0
BLAST of Cla97C01G011280.1 vs. TAIR 10
Match: AT5G06270.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 11 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G11600.1); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). ) HSP 1 Score: 52.4 bits (124), Expect = 2.2e-07 Identity = 24/35 (68.57%), Postives = 27/35 (77.14%), Query Frame = 0
BLAST of Cla97C01G011280.1 vs. TAIR 10
Match: AT3G11600.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to karrikin; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 12 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G06270.1); Has 171 Blast hits to 171 proteins in 15 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 171; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 50.4 bits (119), Expect = 8.2e-07 Identity = 31/63 (49.21%), Postives = 38/63 (60.32%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (97103) v2.5
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|