Chy11G201390.1 (mRNA) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAAGTCGAAGAATCACACAGCTCACAATCAATCCTACAAAGCCCATAAGAACGGCATCAAGAAACCAAGGAAGCACCGCCACACATCCACCAAAGGGGTTTGTGATTTTCTCATACAATCACTTCTGTTCTTATTGAATCCATTGTTTTCATTTTAGTTTGTTTTAATTCTCGTCGATTTTTTCGCAGATGGATCCGAAATTCCTTAGGAACCAGAGGTACGCGAAGAAACACAATAACAAGAGTGGGGAAAATGCTTCTGGGGAAGAGTAA ATGGCGAAGTCGAAGAATCACACAGCTCACAATCAATCCTACAAAGCCCATAAGAACGGCATCAAGAAACCAAGGAAGCACCGCCACACATCCACCAAAGGGATGGATCCGAAATTCCTTAGGAACCAGAGGTACGCGAAGAAACACAATAACAAGAGTGGGGAAAATGCTTCTGGGGAAGAGTAA ATGGCGAAGTCGAAGAATCACACAGCTCACAATCAATCCTACAAAGCCCATAAGAACGGCATCAAGAAACCAAGGAAGCACCGCCACACATCCACCAAAGGGATGGATCCGAAATTCCTTAGGAACCAGAGGTACGCGAAGAAACACAATAACAAGAGTGGGGAAAATGCTTCTGGGGAAGAGTAA MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYAKKHNNKSGENASGEE* Homology
BLAST of Chy11G201390.1 vs. ExPASy Swiss-Prot
Match: Q9M7X7 (60S ribosomal protein L29-1 OS=Arabidopsis thaliana OX=3702 GN=RPL29A PE=1 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 1.3e-22 Identity = 53/61 (86.89%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of Chy11G201390.1 vs. ExPASy Swiss-Prot
Match: Q84WM0 (60S ribosomal protein L29-2 OS=Arabidopsis thaliana OX=3702 GN=RPL29B PE=3 SV=2) HSP 1 Score: 104.8 bits (260), Expect = 3.7e-22 Identity = 53/61 (86.89%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of Chy11G201390.1 vs. ExPASy Swiss-Prot
Match: Q58DW3 (60S ribosomal protein L29 OS=Bos taurus OX=9913 GN=RPL29 PE=2 SV=3) HSP 1 Score: 77.8 bits (190), Expect = 4.8e-14 Identity = 39/52 (75.00%), Postives = 43/52 (82.69%), Query Frame = 0
BLAST of Chy11G201390.1 vs. ExPASy Swiss-Prot
Match: P47914 (60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2) HSP 1 Score: 77.8 bits (190), Expect = 4.8e-14 Identity = 39/52 (75.00%), Postives = 43/52 (82.69%), Query Frame = 0
BLAST of Chy11G201390.1 vs. ExPASy Swiss-Prot
Match: Q8HXB8 (60S ribosomal protein L29 OS=Macaca fascicularis OX=9541 GN=RPL29 PE=2 SV=3) HSP 1 Score: 77.8 bits (190), Expect = 4.8e-14 Identity = 39/52 (75.00%), Postives = 43/52 (82.69%), Query Frame = 0
BLAST of Chy11G201390.1 vs. ExPASy TrEMBL
Match: A0A1S3C7P2 (60S ribosomal protein L29 OS=Cucumis melo OX=3656 GN=LOC103497798 PE=3 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 8.2e-25 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of Chy11G201390.1 vs. ExPASy TrEMBL
Match: A0A1S3C7U0 (60S ribosomal protein L29 OS=Cucumis melo OX=3656 GN=LOC103497797 PE=3 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 4.1e-24 Identity = 60/61 (98.36%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Chy11G201390.1 vs. ExPASy TrEMBL
Match: A0A0A0KCX6 (60S ribosomal protein L29 OS=Cucumis sativus OX=3659 GN=Csa_6G309950 PE=3 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 1.6e-23 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Chy11G201390.1 vs. ExPASy TrEMBL
Match: V9HZW1 (60S ribosomal protein L29 OS=Ipomoea batatas OX=4120 GN=RPL29 PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 4.5e-23 Identity = 58/61 (95.08%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of Chy11G201390.1 vs. ExPASy TrEMBL
Match: A0A2R6PJK9 (60S ribosomal protein L29 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc27140 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 1.3e-22 Identity = 57/61 (93.44%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Chy11G201390.1 vs. NCBI nr
Match: XP_008458371.1 (PREDICTED: 60S ribosomal protein L29-1-like [Cucumis melo]) HSP 1 Score: 122 bits (305), Expect = 8.94e-35 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of Chy11G201390.1 vs. NCBI nr
Match: XP_008458370.1 (PREDICTED: 60S ribosomal protein L29-1 [Cucumis melo]) HSP 1 Score: 119 bits (299), Expect = 7.37e-34 Identity = 60/61 (98.36%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Chy11G201390.1 vs. NCBI nr
Match: XP_011657268.1 (60S ribosomal protein L29-1 [Cucumis sativus] >XP_031743224.1 60S ribosomal protein L29-1 [Cucumis sativus]) HSP 1 Score: 117 bits (294), Expect = 4.27e-33 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Chy11G201390.1 vs. NCBI nr
Match: ADV02780.1 (putative 60S ribosomal protein L29 [Ipomoea batatas]) HSP 1 Score: 116 bits (290), Expect = 1.74e-32 Identity = 58/61 (95.08%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of Chy11G201390.1 vs. NCBI nr
Match: XP_010534701.1 (PREDICTED: 60S ribosomal protein L29-1 [Tarenaya hassleriana]) HSP 1 Score: 115 bits (289), Expect = 2.48e-32 Identity = 57/61 (93.44%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of Chy11G201390.1 vs. TAIR 10
Match: AT3G06700.1 (Ribosomal L29e protein family ) HSP 1 Score: 106.3 bits (264), Expect = 9.0e-24 Identity = 53/61 (86.89%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of Chy11G201390.1 vs. TAIR 10
Match: AT3G06700.2 (Ribosomal L29e protein family ) HSP 1 Score: 106.3 bits (264), Expect = 9.0e-24 Identity = 53/61 (86.89%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of Chy11G201390.1 vs. TAIR 10
Match: AT3G06700.3 (Ribosomal L29e protein family ) HSP 1 Score: 106.3 bits (264), Expect = 9.0e-24 Identity = 53/61 (86.89%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of Chy11G201390.1 vs. TAIR 10
Match: AT3G06680.1 (Ribosomal L29e protein family ) HSP 1 Score: 104.8 bits (260), Expect = 2.6e-23 Identity = 53/61 (86.89%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of Chy11G201390.1 vs. TAIR 10
Match: AT3G06680.2 (Ribosomal L29e protein family ) HSP 1 Score: 104.8 bits (260), Expect = 2.6e-23 Identity = 53/61 (86.89%), Postives = 56/61 (91.80%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|