CcUC10G193490.1 (mRNA) Watermelon (PI 537277) v1

Overview


Name	CcUC10G193490.1
Type	mRNA
Organism	Citrullus colocynthis (Watermelon (PI 537277) v1)
Description	Unknown protein
Location	CicolChr10: 12605277 .. 12605708 (-)
Sequence length	156
RNA-Seq Expression	CcUC10G193490.1
Synteny	CcUC10G193490.1

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideexonCDS

Hold the cursor over a type above to highlight its positions in the sequence below.

TGTAGCATGTACAAGAAAATTCCTCCTGCAACTTTGAACTGTGCGTACTGTACAAAACTTTGTGTCAACTGAGATCCTACAATTCCAATTTTTTGCAAGAATAACACTAATGTCCTTCCTATCCATCACTCTAAAAATGTAACAAAATAAGAACTTCAAATATGTTTATGTTTTTCAGCCTGTAGCATGTACAAGAAAATTCCTCCTGCAACTTTGAACTGTGCGTACTGTACAAAACTTTGTGTCAACTGAGATCCTACAATTCCAATTTTTTGCAAGAATAACACTAATGTCCTTCCTATCCATCACTCTAAAAATGTAACAAAATAAGAACTTCAAATATGTTTATGTTTTTCAGCCTGTAGCATGTACAAGAAAATTCCTCCTGCAACTTTGAACTGTGCGTACTGTACAAAACTTTGTGTCAACTGA

mRNA sequence

TGTAGCATGTACAAGAAAATTCCTCCTGCAACTTTGAACTCCTGTAGCATGTACAAGAAAATTCCTCCTGCAACTTTGAACTCCTGTAGCATGTACAAGAAAATTCCTCCTGCAACTTTGAACTGTGCGTACTGTACAAAACTTTGTGTCAACTGA

Coding sequence (CDS)

TGTAGCATGTACAAGAAAATTCCTCCTGCAACTTTGAACTCCTGTAGCATGTACAAGAAAATTCCTCCTGCAACTTTGAACTCCTGTAGCATGTACAAGAAAATTCCTCCTGCAACTTTGAACTGTGCGTACTGTACAAAACTTTGTGTCAACTGA

Protein sequence

CSMYKKIPPATLNSCSMYKKIPPATLNSCSMYKKIPPATLNCAYCTKLCVN

Homology

The following BLAST results are available for this feature:

BLAST of CcUC10G193490.1 vs.


Match Name	E-value	Identity	Description

BLAST of CcUC10G193490.1 vs.


Match Name	E-value	Identity	Description

BLAST of CcUC10G193490.1 vs.


Match Name	E-value	Identity	Description

BLAST of CcUC10G193490.1 vs.


Match Name	E-value	Identity	Description

Relationships

This mRNA is a part of the following gene feature(s):


Feature Name	Unique Name	Type
CcUC10G193490	CcUC10G193490	gene

The following exon feature(s) are a part of this mRNA:


Feature Name	Unique Name	Type
CcUC10G193490.1-exon	CcUC10G193490.1-exon-CicolChr10:12605277..12605350	exon
CcUC10G193490.1-exon	CcUC10G193490.1-exon-CicolChr10:12605489..12605530	exon
CcUC10G193490.1-exon	CcUC10G193490.1-exon-CicolChr10:12605669..12605708	exon

The following CDS feature(s) are a part of this mRNA:


Feature Name	Unique Name	Type
CcUC10G193490.1-cds	CcUC10G193490.1-cds-CicolChr10:12605277..12605350	CDS
CcUC10G193490.1-cds	CcUC10G193490.1-cds-CicolChr10:12605489..12605530	CDS
CcUC10G193490.1-cds	CcUC10G193490.1-cds-CicolChr10:12605669..12605708	CDS

The following polypeptide feature(s) derives from this mRNA:


Feature Name	Unique Name	Type
CcUC10G193490.1	CcUC10G193490.1-protein	polypeptide