CcUC09G184560.1 (mRNA) Watermelon (PI 537277) v1

Overview


Name	CcUC09G184560.1
Type	mRNA
Organism	Citrullus colocynthis (Watermelon (PI 537277) v1)
Description	Unknown protein
Location	CicolChr09: 35784179 .. 35784355 (-)
Sequence length	114
RNA-Seq Expression	CcUC09G184560.1
Synteny	CcUC09G184560.1

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideexonCDS

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGTTTTGTCGAAATGAGTTTGATGGTTTAGTTAAGGGTCATGTAATGTCGAAAAGAATTACAAAGTTAGATACAAATGAAATAACATAACCTATTTGTGATTAGGTTAATTTAATTTCATGTACAAGTATATGTGCATGTGCAATCTTGGACTATCTGAATCAATTAGCTCTTTTA

mRNA sequence

ATGTTTTGTCGAAATGAGTTTGATGGTTTAGTTAAGGGTCATGTTAATTTAATTTCATGTACAAGTATATGTGCATGTGCAATCTTGGACTATCTGAATCAATTAGCTCTTTTA

Coding sequence (CDS)

ATGTTTTGTCGAAATGAGTTTGATGGTTTAGTTAAGGGTCATGTTAATTTAATTTCATGTACAAGTATATGTGCATGTGCAATCTTGGACTATCTGAATCAATTAGCTCTTTTA

Protein sequence

MFCRNEFDGLVKGHVNLISCTSICACAILDYLNQLALL

Homology

The following BLAST results are available for this feature:

BLAST of CcUC09G184560.1 vs.


Match Name	E-value	Identity	Description

BLAST of CcUC09G184560.1 vs.


Match Name	E-value	Identity	Description

BLAST of CcUC09G184560.1 vs.


Match Name	E-value	Identity	Description

BLAST of CcUC09G184560.1 vs.


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31

Position :

Zoom :

x 1


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	PROSITE	PS51257	PROKAR_LIPOPROTEIN	coord: 1..26 score: 5.0

Relationships

This mRNA is a part of the following gene feature(s):


Feature Name	Unique Name	Type
CcUC09G184560	CcUC09G184560	gene

The following exon feature(s) are a part of this mRNA:


Feature Name	Unique Name	Type
CcUC09G184560.1-exon	CcUC09G184560.1-exon-CicolChr09:35784179..35784250	exon
CcUC09G184560.1-exon	CcUC09G184560.1-exon-CicolChr09:35784314..35784355	exon

The following CDS feature(s) are a part of this mRNA:


Feature Name	Unique Name	Type
CcUC09G184560.1-cds	CcUC09G184560.1-cds-CicolChr09:35784179..35784250	CDS
CcUC09G184560.1-cds	CcUC09G184560.1-cds-CicolChr09:35784314..35784355	CDS

The following polypeptide feature(s) derives from this mRNA:


Feature Name	Unique Name	Type
CcUC09G184560.1	CcUC09G184560.1-protein	polypeptide