
CSPI06G33920.1 (mRNA) Cucumber (PI 183967) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGGGAAAGCCACGGCCATCATAGACCCAATACTGGCTAGAACTTGCATTGATGAAATCGTGAGATGCATCCATCTAGAATTACTGTGTGTTCAAGAAAATGTAGATATCCGACCAACCATGGATTCAGTTGTTTTCATGCTCAATTGCAACTCCGTCACTCTACTTGTACCGTTGCAGCCTGGATTTTTGCTGCAGAGCAATACCTCAAACTTGCCACAGCATCTTGATGATCACACAGAAGGACCACACCATAGTCTATCTGAGAGCTTTTATGTTGAAGAAGAATCGGGAAATCAGTATTCAGCTATTGATATTCAAGCTTACTAG ATGGAAGGGAAAGCCACGGCCATCATAGACCCAATACTGGCTAGAACTTGCATTGATGAAATCGTGAGATGCATCCATCTAGAATTACTGTGTGTTCAAGAAAATGTAGATATCCGACCAACCATGGATTCAGTTGTTTTCATGCTCAATTGCAACTCCGTCACTCTACTTGTACCGTTGCAGCCTGGATTTTTGCTGCAGAGCAATACCTCAAACTTGCCACAGCATCTTGATGATCACACAGAAGGACCACACCATAGTCTATCTGAGAGCTTTTATGTTGAAGAAGAATCGGGAAATCAGTATTCAGCTATTGATATTCAAGCTTACTAG ATGGAAGGGAAAGCCACGGCCATCATAGACCCAATACTGGCTAGAACTTGCATTGATGAAATCGTGAGATGCATCCATCTAGAATTACTGTGTGTTCAAGAAAATGTAGATATCCGACCAACCATGGATTCAGTTGTTTTCATGCTCAATTGCAACTCCGTCACTCTACTTGTACCGTTGCAGCCTGGATTTTTGCTGCAGAGCAATACCTCAAACTTGCCACAGCATCTTGATGATCACACAGAAGGACCACACCATAGTCTATCTGAGAGCTTTTATGTTGAAGAAGAATCGGGAAATCAGTATTCAGCTATTGATATTCAAGCTTACTAG MEGKATAIIDPILARTCIDEIVRCIHLELLCVQENVDIRPTMDSVVFMLNCNSVTLLVPLQPGFLLQSNTSNLPQHLDDHTEGPHHSLSESFYVEEESGNQYSAIDIQAY* Homology
BLAST of CSPI06G33920.1 vs. ExPASy Swiss-Prot
Match: O65468 (Cysteine-rich receptor-like protein kinase 8 OS=Arabidopsis thaliana OX=3702 GN=CRK8 PE=3 SV=2) HSP 1 Score: 71.2 bits (173), Expect = 8.1e-12 Identity = 38/78 (48.72%), Postives = 51/78 (65.38%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. ExPASy Swiss-Prot
Match: O23081 (Cysteine-rich receptor-like protein kinase 41 OS=Arabidopsis thaliana OX=3702 GN=CRK41 PE=3 SV=2) HSP 1 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 38/65 (58.46%), Postives = 44/65 (67.69%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. ExPASy Swiss-Prot
Match: Q9C5S9 (Cysteine-rich receptor-like protein kinase 6 OS=Arabidopsis thaliana OX=3702 GN=CRK6 PE=1 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 4.0e-11 Identity = 37/79 (46.84%), Postives = 49/79 (62.03%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. ExPASy Swiss-Prot
Match: O23082 (Putative receptor-like protein kinase At4g00960 OS=Arabidopsis thaliana OX=3702 GN=At4g00960 PE=3 SV=2) HSP 1 Score: 68.6 bits (166), Expect = 5.2e-11 Identity = 42/85 (49.41%), Postives = 50/85 (58.82%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. ExPASy Swiss-Prot
Match: Q8GYA4 (Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana OX=3702 GN=CRK10 PE=1 SV=3) HSP 1 Score: 68.2 bits (165), Expect = 6.8e-11 Identity = 34/77 (44.16%), Postives = 47/77 (61.04%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. ExPASy TrEMBL
Match: A0A0A0KJZ9 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G516620 PE=4 SV=1) HSP 1 Score: 220.3 bits (560), Expect = 4.0e-54 Identity = 109/110 (99.09%), Postives = 110/110 (100.00%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. ExPASy TrEMBL
Match: A0A1S4DT85 (cysteine-rich receptor-like protein kinase 8 OS=Cucumis melo OX=3656 GN=LOC107990444 PE=4 SV=1) HSP 1 Score: 185.7 bits (470), Expect = 1.1e-43 Identity = 93/107 (86.92%), Postives = 97/107 (90.65%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. ExPASy TrEMBL
Match: A0A6J1GE76 (putative receptor-like protein kinase At4g00960 isoform X3 OS=Cucurbita moschata OX=3662 GN=LOC111453352 PE=4 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 1.5e-32 Identity = 73/102 (71.57%), Postives = 84/102 (82.35%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. ExPASy TrEMBL
Match: A0A6J1GE39 (cysteine-rich receptor-like protein kinase 26 isoform X1 OS=Cucurbita moschata OX=3662 GN=LOC111453352 PE=4 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 1.5e-32 Identity = 73/102 (71.57%), Postives = 84/102 (82.35%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. ExPASy TrEMBL
Match: A0A6J1GE34 (cysteine-rich receptor-like protein kinase 29 isoform X2 OS=Cucurbita moschata OX=3662 GN=LOC111453352 PE=4 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 1.5e-32 Identity = 73/102 (71.57%), Postives = 84/102 (82.35%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. NCBI nr
Match: XP_011658514.1 (putative receptor-like protein kinase At4g00960 [Cucumis sativus] >KGN49154.1 hypothetical protein Csa_003972 [Cucumis sativus]) HSP 1 Score: 220.3 bits (560), Expect = 8.2e-54 Identity = 109/110 (99.09%), Postives = 110/110 (100.00%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. NCBI nr
Match: XP_016899199.1 (PREDICTED: cysteine-rich receptor-like protein kinase 8 [Cucumis melo]) HSP 1 Score: 185.7 bits (470), Expect = 2.2e-43 Identity = 93/107 (86.92%), Postives = 97/107 (90.65%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. NCBI nr
Match: XP_023544482.1 (cysteine-rich receptor-like protein kinase 29 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 154.5 bits (389), Expect = 5.5e-34 Identity = 77/102 (75.49%), Postives = 85/102 (83.33%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. NCBI nr
Match: XP_022950182.1 (cysteine-rich receptor-like protein kinase 29 isoform X2 [Cucurbita moschata]) HSP 1 Score: 148.7 bits (374), Expect = 3.0e-32 Identity = 73/102 (71.57%), Postives = 84/102 (82.35%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. NCBI nr
Match: XP_022950183.1 (putative receptor-like protein kinase At4g00960 isoform X3 [Cucurbita moschata]) HSP 1 Score: 148.7 bits (374), Expect = 3.0e-32 Identity = 73/102 (71.57%), Postives = 84/102 (82.35%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 71.2 bits (173), Expect = 5.7e-13 Identity = 38/78 (48.72%), Postives = 51/78 (65.38%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. TAIR 10
Match: AT4G00970.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 41 ) HSP 1 Score: 70.9 bits (172), Expect = 7.5e-13 Identity = 38/65 (58.46%), Postives = 44/65 (67.69%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. TAIR 10
Match: AT4G23140.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 6 ) HSP 1 Score: 68.9 bits (167), Expect = 2.8e-12 Identity = 37/79 (46.84%), Postives = 49/79 (62.03%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. TAIR 10
Match: AT4G23140.2 (cysteine-rich RLK (RECEPTOR-like protein kinase) 6 ) HSP 1 Score: 68.9 bits (167), Expect = 2.8e-12 Identity = 37/79 (46.84%), Postives = 49/79 (62.03%), Query Frame = 0
BLAST of CSPI06G33920.1 vs. TAIR 10
Match: AT4G00960.1 (Protein kinase superfamily protein ) HSP 1 Score: 68.6 bits (166), Expect = 3.7e-12 Identity = 42/85 (49.41%), Postives = 50/85 (58.82%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (PI 183967) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|