Bhi10M000820 (mRNA) Wax gourd (B227) v1

Overview


Name	Bhi10M000820
Type	mRNA
Organism	Benincasa hispida (Wax gourd (B227) v1)
Description	Unknown protein
Location	chr10: 21979441 .. 21979620 (+)
Sequence length	180
RNA-Seq Expression	Bhi10M000820
Synteny	Bhi10M000820

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: exonCDSpolypeptide

Hold the cursor over a type above to highlight its positions in the sequence below.

CACATCGGAAACAACCCAAAACGGAGGCTGTACGGTCAGAGGCTGGCGGCGATATGCAAGTCGAGCGACAACAGATCGGGGCTGGACGGTGGTCGAGAGGATGAACAGATCTGGAAGCGTGAGGCTGGCTGGGCGGCGCAGACGAAACCCACAAACGGCGCCGACGATGACGGCGACTAA

mRNA sequence

CACATCGGAAACAACCCAAAACGGAGGCTGTACGGTCAGAGGCTGGCGGCGATATGCAAGTCGAGCGACAACAGATCGGGGCTGGACGGTGGTCGAGAGGATGAACAGATCTGGAAGCGTGAGGCTGGCTGGGCGGCGCAGACGAAACCCACAAACGGCGCCGACGATGACGGCGACTAA

Coding sequence (CDS)

CACATCGGAAACAACCCAAAACGGAGGCTGTACGGTCAGAGGCTGGCGGCGATATGCAAGTCGAGCGACAACAGATCGGGGCTGGACGGTGGTCGAGAGGATGAACAGATCTGGAAGCGTGAGGCTGGCTGGGCGGCGCAGACGAAACCCACAAACGGCGCCGACGATGACGGCGACTAA

Protein sequence

HIGNNPKRRLYGQRLAAICKSSDNRSGLDGGREDEQIWKREAGWAAQTKPTNGADDDGD

Homology

The following BLAST results are available for this feature:

BLAST of Bhi10M000820 vs.


Match Name	E-value	Identity	Description

BLAST of Bhi10M000820 vs.


Match Name	E-value	Identity	Description

BLAST of Bhi10M000820 vs.


Match Name	E-value	Identity	Description

BLAST of Bhi10M000820 vs.


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 26..40
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 22..59

Relationships

This mRNA is a part of the following gene feature(s):


Feature Name	Unique Name	Type
Bhi10G000820	Bhi10G000820	gene

The following exon feature(s) are a part of this mRNA:


Feature Name	Unique Name	Type
Bhi10M000820.exon1	Bhi10M000820.exon1	exon

The following CDS feature(s) are a part of this mRNA:


Feature Name	Unique Name	Type
cds.Bhi10M000820	cds.Bhi10M000820	CDS

The following polypeptide feature(s) derives from this mRNA:


Feature Name	Unique Name	Type
Bhi10M000820	Bhi10M000820-protein	polypeptide