Bhi09M001180 (mRNA) Wax gourd (B227) v1

Overview


Name	Bhi09M001180
Type	mRNA
Organism	Benincasa hispida (Wax gourd (B227) v1)
Description	Unknown protein
Location	chr9: 35972860 .. 35973061 (+)
Sequence length	202
RNA-Seq Expression	Bhi09M001180
Synteny	Bhi09M001180

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: exonCDSpolypeptide

Hold the cursor over a type above to highlight its positions in the sequence below.

AGAAGTTACTTTTAAAGAAGATGAAATGTTCATGATAAGCAAAAATGATGATAAAGCAAGATCAAATCTTGAAATTAATAAATTTAAGGTGGAGCATCTATCTAAAAATAGAGAACCCAATATTGAAGTTCATGAAACTAGTGAACCATTGTCTGCTGAAGTAGAAACTTTAGAAGTTGAGGAAGAAATTGAAAATCCTTAA

mRNA sequence

AGAAGTTACTTTTAAAGAAGATGAAATGTTCATGATAAGCAAAAATGATGATAAAGCAAGATCAAATCTTGAAATTAATAAATTTAAGGTGGAGCATCTATCTAAAAATAGAGAACCCAATATTGAAGTTCATGAAACTAGTGAACCATTGTCTGCTGAAGTAGAAACTTTAGAAGTTGAGGAAGAAATTGAAAATCCTTAA

Coding sequence (CDS)

AGAAGTTACTTTTAAAGAAGATGAAATGTTCATGATAAGCAAAAATGATGATAAAGCAAGATCAAATCTTGAAATTAATAAATTTAAGGTGGAGCATCTATCTAAAAATAGAGAACCCAATATTGAAGTTCATGAAACTAGTGAACCATTGTCTGCTGAAGTAGAAACTTTAGAAGTTGAGGAAGAAATTGAAAATCCTTAA

Protein sequence

EVTFKEDEMFMISKNDDKARSNLEINKFKVEHLSKNREPNIEVHETSEPLSAEVETLEVEEEIENP

Homology

The following BLAST results are available for this feature:

BLAST of Bhi09M001180 vs.


Match Name	E-value	Identity	Description

BLAST of Bhi09M001180 vs.


Match Name	E-value	Identity	Description

BLAST of Bhi09M001180 vs.


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 45..66

Relationships

This mRNA is a part of the following gene feature(s):


Feature Name	Unique Name	Type
Bhi09G001180	Bhi09G001180	gene

The following exon feature(s) are a part of this mRNA:


Feature Name	Unique Name	Type
Bhi09M001180.exon1	Bhi09M001180.exon1	exon

The following CDS feature(s) are a part of this mRNA:


Feature Name	Unique Name	Type
cds.Bhi09M001180	cds.Bhi09M001180	CDS

The following polypeptide feature(s) derives from this mRNA:


Feature Name	Unique Name	Type
Bhi09M001180	Bhi09M001180-protein	polypeptide