Spg038937 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTGAACCACACAGAACCTCCAATTTCGAGTACCGAAACAGCTCAGTTTTGGTGGTGAACTACACGAATTACCGAGACTGTATCGTCTCGGATCCGATCGCGAAGTTCGACAATGGAAGCGGCGGCAGTACGATTTTTCGATTGGATCGAGATGGATATTTCTTTTTCATCAGTGGAGATACAGAGCATTGTGTGAACGGGCTTACTGGCGGTGCAAGTGATGGATGA ATGTCTGAACCACACAGAACCTCCAATTTCGAGTACCGAAACAGCTCAGTTTTGGTGGTGAACTACACGAATTACCGAGACTGTATCGTCTCGGATCCGATCGCGAAGTTCGACAATGGAAGCGGCGGCAGTACGATTTTTCGATTGGATCGAGATGGATATTTCTTTTTCATCAGTGGAGATACAGAGCATTGTGTGAACGGGCTTACTGGCGGTGCAAGTGATGGATGA ATGTCTGAACCACACAGAACCTCCAATTTCGAGTACCGAAACAGCTCAGTTTTGGTGGTGAACTACACGAATTACCGAGACTGTATCGTCTCGGATCCGATCGCGAAGTTCGACAATGGAAGCGGCGGCAGTACGATTTTTCGATTGGATCGAGATGGATATTTCTTTTTCATCAGTGGAGATACAGAGCATTGTGTGAACGGGCTTACTGGCGGTGCAAGTGATGGATGA MSEPHRTSNFEYRNSSVLVVNYTNYRDCIVSDPIAKFDNGSGGSTIFRLDRDGYFFFISGDTEHCVNGLTGGASDG Homology
BLAST of Spg038937 vs. NCBI nr
Match: XP_038899661.1 (mavicyanin-like [Benincasa hispida]) HSP 1 Score: 114.8 bits (286), Expect = 3.3e-22 Identity = 52/62 (83.87%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of Spg038937 vs. NCBI nr
Match: XP_022941044.1 (mavicyanin-like [Cucurbita moschata]) HSP 1 Score: 110.9 bits (276), Expect = 4.8e-21 Identity = 49/62 (79.03%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of Spg038937 vs. NCBI nr
Match: KAG6607745.1 (Early nodulin-like protein 2, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 110.9 bits (276), Expect = 4.8e-21 Identity = 49/62 (79.03%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of Spg038937 vs. NCBI nr
Match: XP_022981622.1 (mavicyanin-like [Cucurbita maxima]) HSP 1 Score: 109.8 bits (273), Expect = 1.1e-20 Identity = 49/62 (79.03%), Postives = 53/62 (85.48%), Query Frame = 0
BLAST of Spg038937 vs. NCBI nr
Match: KAG7037323.1 (Early nodulin-like protein 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 109.8 bits (273), Expect = 1.1e-20 Identity = 49/62 (79.03%), Postives = 53/62 (85.48%), Query Frame = 0
BLAST of Spg038937 vs. ExPASy Swiss-Prot
Match: Q5JNJ5 (Early nodulin-like protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=ENODL1 PE=1 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.7e-05 Identity = 21/53 (39.62%), Postives = 32/53 (60.38%), Query Frame = 0
BLAST of Spg038937 vs. ExPASy Swiss-Prot
Match: Q9SK27 (Early nodulin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At2g25060 PE=2 SV=2) HSP 1 Score: 44.3 bits (103), Expect = 7.2e-04 Identity = 24/59 (40.68%), Postives = 31/59 (52.54%), Query Frame = 0
BLAST of Spg038937 vs. ExPASy TrEMBL
Match: A0A6J1FM27 (mavicyanin-like OS=Cucurbita moschata OX=3662 GN=LOC111446449 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 2.3e-21 Identity = 49/62 (79.03%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of Spg038937 vs. ExPASy TrEMBL
Match: A0A6J1IUH6 (mavicyanin-like OS=Cucurbita maxima OX=3661 GN=LOC111480686 PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 5.2e-21 Identity = 49/62 (79.03%), Postives = 53/62 (85.48%), Query Frame = 0
BLAST of Spg038937 vs. ExPASy TrEMBL
Match: A0A0A0K3H5 (Phytocyanin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_7G121850 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 5.4e-18 Identity = 45/62 (72.58%), Postives = 52/62 (83.87%), Query Frame = 0
BLAST of Spg038937 vs. ExPASy TrEMBL
Match: A0A6J1CEK4 (mavicyanin-like OS=Momordica charantia OX=3673 GN=LOC111010506 PE=4 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 9.5e-15 Identity = 42/62 (67.74%), Postives = 50/62 (80.65%), Query Frame = 0
BLAST of Spg038937 vs. ExPASy TrEMBL
Match: A0A2N9HI80 (Phytocyanin domain-containing protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS39517 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 1.3e-11 Identity = 35/62 (56.45%), Postives = 48/62 (77.42%), Query Frame = 0
BLAST of Spg038937 vs. TAIR 10
Match: AT1G79800.1 (early nodulin-like protein 7 ) HSP 1 Score: 55.1 bits (131), Expect = 2.9e-08 Identity = 27/60 (45.00%), Postives = 36/60 (60.00%), Query Frame = 0
BLAST of Spg038937 vs. TAIR 10
Match: AT3G18590.1 (early nodulin-like protein 5 ) HSP 1 Score: 50.4 bits (119), Expect = 7.2e-07 Identity = 26/62 (41.94%), Postives = 35/62 (56.45%), Query Frame = 0
BLAST of Spg038937 vs. TAIR 10
Match: AT1G48940.1 (early nodulin-like protein 6 ) HSP 1 Score: 49.7 bits (117), Expect = 1.2e-06 Identity = 25/62 (40.32%), Postives = 35/62 (56.45%), Query Frame = 0
BLAST of Spg038937 vs. TAIR 10
Match: AT5G53870.1 (early nodulin-like protein 1 ) HSP 1 Score: 45.1 bits (105), Expect = 3.0e-05 Identity = 22/55 (40.00%), Postives = 32/55 (58.18%), Query Frame = 0
BLAST of Spg038937 vs. TAIR 10
Match: AT5G57920.1 (early nodulin-like protein 10 ) HSP 1 Score: 44.7 bits (104), Expect = 3.9e-05 Identity = 24/59 (40.68%), Postives = 31/59 (52.54%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|