Spg033986 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGCTTTCACCTCAGCAGCTGAACGCCTACGATGGCACCGACCCATCGAAGCCCATCTATGTGGCTGTGAAGGGCCGCATCTTCGACGTCACAAGAGGGGATTCTTTCTACGGCCCCGGCGGCGCTTATGCCATGTTCGCCGGCAAGGACGCCAGCAGAGCTCTGGCCAAGATGACCAAGAGCGAGGAGGAAATCACCTCTTCACTCGAAGGCCTCTCTGAGAAAGAGATGGGTGTTCTCAACGACTGGGAGAAGAAATTCGAAGCTAAGTACCCTATTGTTGGTCGTGTTGTTCCTTAA ATGGAGCTTTCACCTCAGCAGCTGAACGCCTACGATGGCACCGACCCATCGAAGCCCATCTATGTGGCTGTGAAGGGCCGCATCTTCGACGTCACAAGAGGGGATTCTTTCTACGGCCCCGGCGGCGCTTATGCCATGTTCGCCGGCAAGGACGCCAGCAGAGCTCTGGCCAAGATGACCAAGAGCGAGGAGGAAATCACCTCTTCACTCGAAGGCCTCTCTGAGAAAGAGATGGGTGTTCTCAACGACTGGGAGAAGAAATTCGAAGCTAAGTACCCTATTGTTGGTCGTGTTGTTCCTTAA ATGGAGCTTTCACCTCAGCAGCTGAACGCCTACGATGGCACCGACCCATCGAAGCCCATCTATGTGGCTGTGAAGGGCCGCATCTTCGACGTCACAAGAGGGGATTCTTTCTACGGCCCCGGCGGCGCTTATGCCATGTTCGCCGGCAAGGACGCCAGCAGAGCTCTGGCCAAGATGACCAAGAGCGAGGAGGAAATCACCTCTTCACTCGAAGGCCTCTCTGAGAAAGAGATGGGTGTTCTCAACGACTGGGAGAAGAAATTCGAAGCTAAGTACCCTATTGTTGGTCGTGTTGTTCCTTAA MELSPQQLNAYDGTDPSKPIYVAVKGRIFDVTRGDSFYGPGGAYAMFAGKDASRALAKMTKSEEEITSSLEGLSEKEMGVLNDWEKKFEAKYPIVGRVVP Homology
BLAST of Spg033986 vs. NCBI nr
Match: XP_022131551.1 (probable steroid-binding protein 3 [Momordica charantia]) HSP 1 Score: 183.0 bits (463), Expect = 1.3e-42 Identity = 89/99 (89.90%), Postives = 95/99 (95.96%), Query Frame = 0
BLAST of Spg033986 vs. NCBI nr
Match: XP_022997574.1 (probable steroid-binding protein 3 [Cucurbita maxima]) HSP 1 Score: 181.4 bits (459), Expect = 3.8e-42 Identity = 89/99 (89.90%), Postives = 95/99 (95.96%), Query Frame = 0
BLAST of Spg033986 vs. NCBI nr
Match: XP_022962142.1 (probable steroid-binding protein 3 [Cucurbita moschata] >KAG6598539.1 putative steroid-binding protein 3, partial [Cucurbita argyrosperma subsp. sororia] >KAG7029471.1 putative steroid-binding protein 3, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 178.3 bits (451), Expect = 3.2e-41 Identity = 88/99 (88.89%), Postives = 94/99 (94.95%), Query Frame = 0
BLAST of Spg033986 vs. NCBI nr
Match: XP_019252606.1 (PREDICTED: probable steroid-binding protein 3 [Nicotiana attenuata] >OIS99844.1 putative steroid-binding protein 3 [Nicotiana attenuata]) HSP 1 Score: 177.9 bits (450), Expect = 4.2e-41 Identity = 84/99 (84.85%), Postives = 93/99 (93.94%), Query Frame = 0
BLAST of Spg033986 vs. NCBI nr
Match: XP_009605541.1 (probable steroid-binding protein 3 [Nicotiana tomentosiformis] >XP_016479890.1 PREDICTED: probable steroid-binding protein 3 [Nicotiana tabacum]) HSP 1 Score: 177.9 bits (450), Expect = 4.2e-41 Identity = 84/99 (84.85%), Postives = 93/99 (93.94%), Query Frame = 0
BLAST of Spg033986 vs. ExPASy Swiss-Prot
Match: Q9SK39 (Probable steroid-binding protein 3 OS=Arabidopsis thaliana OX=3702 GN=MP3 PE=1 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 8.5e-37 Identity = 71/99 (71.72%), Postives = 86/99 (86.87%), Query Frame = 0
BLAST of Spg033986 vs. ExPASy Swiss-Prot
Match: Q9FVZ7 (Membrane steroid-binding protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=MSBP1 PE=1 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 2.6e-25 Identity = 53/97 (54.64%), Postives = 70/97 (72.16%), Query Frame = 0
BLAST of Spg033986 vs. ExPASy Swiss-Prot
Match: Q9FVZ9 (Membrane steroid-binding protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=MSBP2 PE=2 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 7.5e-25 Identity = 51/97 (52.58%), Postives = 72/97 (74.23%), Query Frame = 0
BLAST of Spg033986 vs. ExPASy Swiss-Prot
Match: Q9XFM6 (Membrane steroid-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=MSBP1 PE=1 SV=2) HSP 1 Score: 113.2 bits (282), Expect = 1.7e-24 Identity = 52/97 (53.61%), Postives = 71/97 (73.20%), Query Frame = 0
BLAST of Spg033986 vs. ExPASy Swiss-Prot
Match: Q9M2Z4 (Membrane steroid-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=MSBP2 PE=1 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 6.3e-24 Identity = 49/97 (50.52%), Postives = 71/97 (73.20%), Query Frame = 0
BLAST of Spg033986 vs. ExPASy TrEMBL
Match: A0A6J1BPT6 (probable steroid-binding protein 3 OS=Momordica charantia OX=3673 GN=LOC111004708 PE=4 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 6.3e-43 Identity = 89/99 (89.90%), Postives = 95/99 (95.96%), Query Frame = 0
BLAST of Spg033986 vs. ExPASy TrEMBL
Match: A0A6J1KBX0 (probable steroid-binding protein 3 OS=Cucurbita maxima OX=3661 GN=LOC111492464 PE=4 SV=1) HSP 1 Score: 181.4 bits (459), Expect = 1.8e-42 Identity = 89/99 (89.90%), Postives = 95/99 (95.96%), Query Frame = 0
BLAST of Spg033986 vs. ExPASy TrEMBL
Match: A0A6J1HBX6 (probable steroid-binding protein 3 OS=Cucurbita moschata OX=3662 GN=LOC111462683 PE=4 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 1.6e-41 Identity = 88/99 (88.89%), Postives = 94/99 (94.95%), Query Frame = 0
BLAST of Spg033986 vs. ExPASy TrEMBL
Match: A0A1S4ATJ6 (probable steroid-binding protein 3 OS=Nicotiana tabacum OX=4097 GN=LOC107801122 PE=4 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 2.0e-41 Identity = 84/99 (84.85%), Postives = 93/99 (93.94%), Query Frame = 0
BLAST of Spg033986 vs. ExPASy TrEMBL
Match: A0A1J6I4A9 (Putative steroid-binding protein 3 OS=Nicotiana attenuata OX=49451 GN=MP3 PE=4 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 2.0e-41 Identity = 84/99 (84.85%), Postives = 93/99 (93.94%), Query Frame = 0
BLAST of Spg033986 vs. TAIR 10
Match: AT2G24940.1 (membrane-associated progesterone binding protein 2 ) HSP 1 Score: 154.1 bits (388), Expect = 6.1e-38 Identity = 71/99 (71.72%), Postives = 86/99 (86.87%), Query Frame = 0
BLAST of Spg033986 vs. TAIR 10
Match: AT5G52240.1 (membrane steroid binding protein 1 ) HSP 1 Score: 113.2 bits (282), Expect = 1.2e-25 Identity = 52/97 (53.61%), Postives = 71/97 (73.20%), Query Frame = 0
BLAST of Spg033986 vs. TAIR 10
Match: AT5G52240.2 (membrane steroid binding protein 1 ) HSP 1 Score: 113.2 bits (282), Expect = 1.2e-25 Identity = 52/97 (53.61%), Postives = 71/97 (73.20%), Query Frame = 0
BLAST of Spg033986 vs. TAIR 10
Match: AT3G48890.1 (membrane-associated progesterone binding protein 3 ) HSP 1 Score: 111.3 bits (277), Expect = 4.5e-25 Identity = 49/97 (50.52%), Postives = 71/97 (73.20%), Query Frame = 0
BLAST of Spg033986 vs. TAIR 10
Match: AT4G14965.1 (membrane-associated progesterone binding protein 4 ) HSP 1 Score: 82.0 bits (201), Expect = 2.9e-16 Identity = 40/96 (41.67%), Postives = 58/96 (60.42%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|