Spg021974 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGACTCCAACAAGATCGGAATCCCTTTCGCTTCTTCGCTCTCTGCTCCGCACAGCCCGTCACTTCTGCGATTACAACATCAGAGAGTACGCCAAACGCCGCGCCGTCGACGGCTTCCGCCATAACCGGAACCTCTCCGATCCTTCATCCATCTCCTCCGCCTACGCCGACGGCAAGGCGCAGCTTGAAGTTGCCAAGAGACAGTCCGCCGTCTACTCCCTCTTCTCGCCCAAGGCCAAGAGCATCATGGAGGCTCATCACACAAACTGA ATGGCGACTCCAACAAGATCGGAATCCCTTTCGCTTCTTCGCTCTCTGCTCCGCACAGCCCGTCACTTCTGCGATTACAACATCAGAGAGTACGCCAAACGCCGCGCCGTCGACGGCTTCCGCCATAACCGGAACCTCTCCGATCCTTCATCCATCTCCTCCGCCTACGCCGACGGCAAGGCGCAGCTTGAAGTTGCCAAGAGACAGTCCGCCGTCTACTCCCTCTTCTCGCCCAAGGCCAAGAGCATCATGGAGGCTCATCACACAAACTGA ATGGCGACTCCAACAAGATCGGAATCCCTTTCGCTTCTTCGCTCTCTGCTCCGCACAGCCCGTCACTTCTGCGATTACAACATCAGAGAGTACGCCAAACGCCGCGCCGTCGACGGCTTCCGCCATAACCGGAACCTCTCCGATCCTTCATCCATCTCCTCCGCCTACGCCGACGGCAAGGCGCAGCTTGAAGTTGCCAAGAGACAGTCCGCCGTCTACTCCCTCTTCTCGCCCAAGGCCAAGAGCATCATGGAGGCTCATCACACAAACTGA MATPTRSESLSLLRSLLRTARHFCDYNIREYAKRRAVDGFRHNRNLSDPSSISSAYADGKAQLEVAKRQSAVYSLFSPKAKSIMEAHHTN Homology
BLAST of Spg021974 vs. NCBI nr
Match: XP_022932898.1 (LYR motif-containing protein 4 [Cucurbita moschata] >XP_022973088.1 LYR motif-containing protein 4 [Cucurbita maxima] >XP_023531294.1 LYR motif-containing protein 4 [Cucurbita pepo subsp. pepo] >KAG7021536.1 LYR motif-containing protein 4, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 167.9 bits (424), Expect = 3.9e-38 Identity = 86/90 (95.56%), Postives = 86/90 (95.56%), Query Frame = 0
BLAST of Spg021974 vs. NCBI nr
Match: XP_038879775.1 (LYR motif-containing protein 4-like [Benincasa hispida]) HSP 1 Score: 158.7 bits (400), Expect = 2.4e-35 Identity = 80/90 (88.89%), Postives = 83/90 (92.22%), Query Frame = 0
BLAST of Spg021974 vs. NCBI nr
Match: XP_011660289.1 (LYR motif-containing protein 4 [Cucumis sativus]) HSP 1 Score: 156.8 bits (395), Expect = 9.0e-35 Identity = 80/90 (88.89%), Postives = 84/90 (93.33%), Query Frame = 0
BLAST of Spg021974 vs. NCBI nr
Match: XP_008453246.1 (PREDICTED: LYR motif-containing protein 4 [Cucumis melo] >KAA0057977.1 LYR motif-containing protein 4 [Cucumis melo var. makuwa]) HSP 1 Score: 156.4 bits (394), Expect = 1.2e-34 Identity = 78/90 (86.67%), Postives = 84/90 (93.33%), Query Frame = 0
BLAST of Spg021974 vs. NCBI nr
Match: XP_022134602.1 (LYR motif-containing protein 4-like [Momordica charantia]) HSP 1 Score: 156.0 bits (393), Expect = 1.5e-34 Identity = 77/90 (85.56%), Postives = 84/90 (93.33%), Query Frame = 0
BLAST of Spg021974 vs. ExPASy Swiss-Prot
Match: Q8K215 (LYR motif-containing protein 4 OS=Mus musculus OX=10090 GN=Lyrm4 PE=1 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 5.2e-09 Identity = 31/77 (40.26%), Postives = 46/77 (59.74%), Query Frame = 0
BLAST of Spg021974 vs. ExPASy Swiss-Prot
Match: B8JLQ0 (LYR motif-containing protein 4 OS=Danio rerio OX=7955 GN=lyrm4 PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.1e-06 Identity = 29/88 (32.95%), Postives = 50/88 (56.82%), Query Frame = 0
BLAST of Spg021974 vs. ExPASy Swiss-Prot
Match: Q6Q560 (Protein ISD11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISD11 PE=1 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 5.4e-06 Identity = 26/74 (35.14%), Postives = 40/74 (54.05%), Query Frame = 0
BLAST of Spg021974 vs. ExPASy Swiss-Prot
Match: O46098 (Protein bcn92 OS=Drosophila melanogaster OX=7227 GN=bcn92 PE=1 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 9.2e-06 Identity = 28/73 (38.36%), Postives = 43/73 (58.90%), Query Frame = 0
BLAST of Spg021974 vs. ExPASy Swiss-Prot
Match: Q54FN9 (LYR motif-containing protein 4 OS=Dictyostelium discoideum OX=44689 GN=lyrm4 PE=3 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 9.2e-06 Identity = 29/72 (40.28%), Postives = 41/72 (56.94%), Query Frame = 0
BLAST of Spg021974 vs. ExPASy TrEMBL
Match: A0A6J1IC29 (LYR motif-containing protein 4 OS=Cucurbita maxima OX=3661 GN=LOC111471615 PE=4 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 1.9e-38 Identity = 86/90 (95.56%), Postives = 86/90 (95.56%), Query Frame = 0
BLAST of Spg021974 vs. ExPASy TrEMBL
Match: A0A6J1F322 (LYR motif-containing protein 4 OS=Cucurbita moschata OX=3662 GN=LOC111439443 PE=4 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 1.9e-38 Identity = 86/90 (95.56%), Postives = 86/90 (95.56%), Query Frame = 0
BLAST of Spg021974 vs. ExPASy TrEMBL
Match: A0A0A0LPH2 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G012090 PE=4 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 4.4e-35 Identity = 80/90 (88.89%), Postives = 84/90 (93.33%), Query Frame = 0
BLAST of Spg021974 vs. ExPASy TrEMBL
Match: A0A5A7UTC8 (LYR motif-containing protein 4 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold274G002810 PE=4 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 5.7e-35 Identity = 78/90 (86.67%), Postives = 84/90 (93.33%), Query Frame = 0
BLAST of Spg021974 vs. ExPASy TrEMBL
Match: A0A1S3BV74 (LYR motif-containing protein 4 OS=Cucumis melo OX=3656 GN=LOC103494022 PE=4 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 5.7e-35 Identity = 78/90 (86.67%), Postives = 84/90 (93.33%), Query Frame = 0
BLAST of Spg021974 vs. TAIR 10
Match: AT5G61220.1 (LYR family of Fe/S cluster biogenesis protein ) HSP 1 Score: 94.0 bits (232), Expect = 6.7e-20 Identity = 48/79 (60.76%), Postives = 59/79 (74.68%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
|