
Spg020908 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTCAGAAGCGGAAGCCATAGCCCGAAAAGGAAGTACACAGGAGTTTACAAGAGGCGATGGGGGAAATGGCTTACGCAGATCAAGAAGCCCAGAGAGCAGAAGCAGATTTGGGTTGGCACCTTTGACACGCCGGAGATGGCGGCACTGGCCTTTGACGTCGCCGCCTTCCACTTCCGTGGCCACGGCGCTAAACTCAACTTTCCGGAGCATGTCGAGAGCCTCCCCTCACTCCCACCCAGCTCCACTGAAGAAGAGATCAAGACCGCCGCAAGAGAAACAGCACTTCGTCCCCTGGCAACAGCCGCGGAGGGCGGTGGAGCTCTCTATGAGAATGGGGAATGGGATTGGGAGGGCGGTTTGGAAGCCATTGAAATGTTTCAATGGCCATAG ATGCTCAGAAGCGGAAGCCATAGCCCGAAAAGGAAGTACACAGGAGTTTACAAGAGGCGATGGGGGAAATGGCTTACGCAGATCAAGAAGCCCAGAGAGCAGAAGCAGATTTGGGTTGGCACCTTTGACACGCCGGAGATGGCGGCACTGGCCTTTGACGTCGCCGCCTTCCACTTCCGTGGCCACGGCGCTAAACTCAACTTTCCGGAGCATGTCGAGAGCCTCCCCTCACTCCCACCCAGCTCCACTGAAGAAGAGATCAAGACCGCCGCAAGAGAAACAGCACTTCGTCCCCTGGCAACAGCCGCGGAGGGCGGTGGAGCTCTCTATGAGAATGGGGAATGGGATTGGGAGGGCGGTTTGGAAGCCATTGAAATGTTTCAATGGCCATAG ATGCTCAGAAGCGGAAGCCATAGCCCGAAAAGGAAGTACACAGGAGTTTACAAGAGGCGATGGGGGAAATGGCTTACGCAGATCAAGAAGCCCAGAGAGCAGAAGCAGATTTGGGTTGGCACCTTTGACACGCCGGAGATGGCGGCACTGGCCTTTGACGTCGCCGCCTTCCACTTCCGTGGCCACGGCGCTAAACTCAACTTTCCGGAGCATGTCGAGAGCCTCCCCTCACTCCCACCCAGCTCCACTGAAGAAGAGATCAAGACCGCCGCAAGAGAAACAGCACTTCGTCCCCTGGCAACAGCCGCGGAGGGCGGTGGAGCTCTCTATGAGAATGGGGAATGGGATTGGGAGGGCGGTTTGGAAGCCATTGAAATGTTTCAATGGCCATAG MLRSGSHSPKRKYTGVYKRRWGKWLTQIKKPREQKQIWVGTFDTPEMAALAFDVAAFHFRGHGAKLNFPEHVESLPSLPPSSTEEEIKTAARETALRPLATAAEGGGALYENGEWDWEGGLEAIEMFQWP Homology
BLAST of Spg020908 vs. NCBI nr
Match: QNI23816.1 (AP2/ERF transcription factor [Camptotheca acuminata]) HSP 1 Score: 116.3 bits (290), Expect = 2.0e-22 Identity = 59/112 (52.68%), Postives = 77/112 (68.75%), Query Frame = 0
BLAST of Spg020908 vs. NCBI nr
Match: APQ47333.1 (AP2/ERF domain-containing transcription factor, partial [Vernicia montana]) HSP 1 Score: 115.2 bits (287), Expect = 4.4e-22 Identity = 57/97 (58.76%), Postives = 73/97 (75.26%), Query Frame = 0
BLAST of Spg020908 vs. NCBI nr
Match: XP_034677440.1 (ethylene-responsive transcription factor ERF021-like [Vitis riparia]) HSP 1 Score: 114.4 bits (285), Expect = 7.4e-22 Identity = 58/103 (56.31%), Postives = 75/103 (72.82%), Query Frame = 0
BLAST of Spg020908 vs. NCBI nr
Match: XP_011005172.1 (PREDICTED: ethylene-responsive transcription factor ERF021-like [Populus euphratica]) HSP 1 Score: 112.8 bits (281), Expect = 2.2e-21 Identity = 54/102 (52.94%), Postives = 75/102 (73.53%), Query Frame = 0
BLAST of Spg020908 vs. NCBI nr
Match: XP_010645899.1 (PREDICTED: ethylene-responsive transcription factor ERF021 [Vitis vinifera] >RVW33208.1 Ethylene-responsive transcription factor ERF021 [Vitis vinifera] >CAN74966.1 hypothetical protein VITISV_038046 [Vitis vinifera] >CBI31325.3 unnamed protein product, partial [Vitis vinifera]) HSP 1 Score: 112.8 bits (281), Expect = 2.2e-21 Identity = 57/103 (55.34%), Postives = 74/103 (71.84%), Query Frame = 0
BLAST of Spg020908 vs. ExPASy Swiss-Prot
Match: Q9C9I2 (Ethylene-responsive transcription factor ERF021 OS=Arabidopsis thaliana OX=3702 GN=ERF021 PE=2 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 1.1e-20 Identity = 46/84 (54.76%), Postives = 62/84 (73.81%), Query Frame = 0
BLAST of Spg020908 vs. ExPASy Swiss-Prot
Match: Q9LQ28 (Ethylene-responsive transcription factor ERF022 OS=Arabidopsis thaliana OX=3702 GN=ERF022 PE=2 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 3.6e-19 Identity = 42/84 (50.00%), Postives = 63/84 (75.00%), Query Frame = 0
BLAST of Spg020908 vs. ExPASy Swiss-Prot
Match: Q1ECI2 (Ethylene-responsive transcription factor ERF023 OS=Arabidopsis thaliana OX=3702 GN=ERF023 PE=2 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 4.7e-19 Identity = 49/108 (45.37%), Postives = 72/108 (66.67%), Query Frame = 0
BLAST of Spg020908 vs. ExPASy Swiss-Prot
Match: P93007 (Ethylene-responsive transcription factor ERF112 OS=Arabidopsis thaliana OX=3702 GN=ERF112 PE=1 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 6.1e-19 Identity = 42/76 (55.26%), Postives = 55/76 (72.37%), Query Frame = 0
BLAST of Spg020908 vs. ExPASy Swiss-Prot
Match: Q70II3 (Ethylene-responsive transcription factor ERF110 OS=Arabidopsis thaliana OX=3702 GN=ERF110 PE=2 SV=2) HSP 1 Score: 88.6 bits (218), Expect = 5.7e-17 Identity = 40/71 (56.34%), Postives = 49/71 (69.01%), Query Frame = 0
BLAST of Spg020908 vs. ExPASy TrEMBL
Match: A0A7G8AUE7 (AP2/ERF transcription factor OS=Camptotheca acuminata OX=16922 PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 9.5e-23 Identity = 59/112 (52.68%), Postives = 77/112 (68.75%), Query Frame = 0
BLAST of Spg020908 vs. ExPASy TrEMBL
Match: A0A1L6CAX0 (AP2/ERF domain-containing transcription factor (Fragment) OS=Vernicia montana OX=316732 PE=2 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 2.1e-22 Identity = 57/97 (58.76%), Postives = 73/97 (75.26%), Query Frame = 0
BLAST of Spg020908 vs. ExPASy TrEMBL
Match: A5BSM2 (AP2/ERF domain-containing protein OS=Vitis vinifera OX=29760 GN=VIT_18s0001g05890 PE=4 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 1.0e-21 Identity = 57/103 (55.34%), Postives = 74/103 (71.84%), Query Frame = 0
BLAST of Spg020908 vs. ExPASy TrEMBL
Match: A0A438DCP1 (Ethylene-responsive transcription factor ERF021 OS=Vitis vinifera OX=29760 GN=ERF021_1 PE=4 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 1.0e-21 Identity = 57/103 (55.34%), Postives = 74/103 (71.84%), Query Frame = 0
BLAST of Spg020908 vs. ExPASy TrEMBL
Match: A0A7J7D6L0 (Ethylene-responsive transcription factor OS=Tripterygium wilfordii OX=458696 GN=HS088_TW10G00941 PE=4 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 1.0e-21 Identity = 56/102 (54.90%), Postives = 79/102 (77.45%), Query Frame = 0
BLAST of Spg020908 vs. TAIR 10
Match: AT1G71450.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 100.9 bits (250), Expect = 7.9e-22 Identity = 46/84 (54.76%), Postives = 62/84 (73.81%), Query Frame = 0
BLAST of Spg020908 vs. TAIR 10
Match: AT1G33760.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 95.9 bits (237), Expect = 2.5e-20 Identity = 42/84 (50.00%), Postives = 63/84 (75.00%), Query Frame = 0
BLAST of Spg020908 vs. TAIR 10
Match: AT1G01250.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 95.5 bits (236), Expect = 3.3e-20 Identity = 49/108 (45.37%), Postives = 72/108 (66.67%), Query Frame = 0
BLAST of Spg020908 vs. TAIR 10
Match: AT2G33710.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 95.1 bits (235), Expect = 4.3e-20 Identity = 42/76 (55.26%), Postives = 55/76 (72.37%), Query Frame = 0
BLAST of Spg020908 vs. TAIR 10
Match: AT2G33710.2 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 95.1 bits (235), Expect = 4.3e-20 Identity = 42/76 (55.26%), Postives = 55/76 (72.37%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|