Spg017722 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCCGTGGAAGCTGCCTTGCAAAACAATGATGCACTGCTCCAAGACTCGAAAGATATCAAATGTGGTGGTTGGGTACCGATTGAGAATATCAATGACCCATATGTGCAAGAGATTGGAAGGTTTGCAGTGATGGAGCATGACAAGATAAGTGGAGACGATATAATTTTCATGCGTGTGTCCAAGGGTTGGACTGGAGTTGTAGCTGGAGTACTTTACCGCCTTGTGATAGAGGCAACAAGAAAGGGTGACAACTGCATCCTATTTTATGAGGCTGAGGTGTGGGATAAGCCATGGGAGTCCATATGGACTCTCACATCTTTTAAACCTCTCCTCAAGGTTTAA ATGAGTTCCGTGGAAGCTGCCTTGCAAAACAATGATGCACTGCTCCAAGACTCGAAAGATATCAAATGTGGTGGTTGGGTACCGATTGAGAATATCAATGACCCATATGTGCAAGAGATTGGAAGGTTTGCAGTGATGGAGCATGACAAGATAAGTGGAGACGATATAATTTTCATGCGTGTGTCCAAGGGTTGGACTGGAGTTGTAGCTGGAGTACTTTACCGCCTTGTGATAGAGGCAACAAGAAAGGGTGACAACTGCATCCTATTTTATGAGGCTGAGGTGTGGGATAAGCCATGGGAGTCCATATGGACTCTCACATCTTTTAAACCTCTCCTCAAGGTTTAA ATGAGTTCCGTGGAAGCTGCCTTGCAAAACAATGATGCACTGCTCCAAGACTCGAAAGATATCAAATGTGGTGGTTGGGTACCGATTGAGAATATCAATGACCCATATGTGCAAGAGATTGGAAGGTTTGCAGTGATGGAGCATGACAAGATAAGTGGAGACGATATAATTTTCATGCGTGTGTCCAAGGGTTGGACTGGAGTTGTAGCTGGAGTACTTTACCGCCTTGTGATAGAGGCAACAAGAAAGGGTGACAACTGCATCCTATTTTATGAGGCTGAGGTGTGGGATAAGCCATGGGAGTCCATATGGACTCTCACATCTTTTAAACCTCTCCTCAAGGTTTAA MSSVEAALQNNDALLQDSKDIKCGGWVPIENINDPYVQEIGRFAVMEHDKISGDDIIFMRVSKGWTGVVAGVLYRLVIEATRKGDNCILFYEAEVWDKPWESIWTLTSFKPLLKV Homology
BLAST of Spg017722 vs. NCBI nr
Match: KAG6592147.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 153.3 bits (386), Expect = 1.3e-33 Identity = 74/114 (64.91%), Postives = 87/114 (76.32%), Query Frame = 0
BLAST of Spg017722 vs. NCBI nr
Match: XP_022936214.1 (cysteine proteinase inhibitor 1-like [Cucurbita moschata]) HSP 1 Score: 152.5 bits (384), Expect = 2.2e-33 Identity = 74/114 (64.91%), Postives = 87/114 (76.32%), Query Frame = 0
BLAST of Spg017722 vs. NCBI nr
Match: XP_022975715.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 149.4 bits (376), Expect = 1.8e-32 Identity = 71/114 (62.28%), Postives = 87/114 (76.32%), Query Frame = 0
BLAST of Spg017722 vs. NCBI nr
Match: XP_023536175.1 (cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo] >XP_023536177.1 cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo] >XP_023536179.1 cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 149.1 bits (375), Expect = 2.4e-32 Identity = 72/114 (63.16%), Postives = 86/114 (75.44%), Query Frame = 0
BLAST of Spg017722 vs. NCBI nr
Match: XP_022936216.1 (cysteine proteinase inhibitor 1-like [Cucurbita moschata]) HSP 1 Score: 148.3 bits (373), Expect = 4.1e-32 Identity = 72/114 (63.16%), Postives = 85/114 (74.56%), Query Frame = 0
BLAST of Spg017722 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 92.8 bits (229), Expect = 2.7e-18 Identity = 46/98 (46.94%), Postives = 62/98 (63.27%), Query Frame = 0
BLAST of Spg017722 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.7e-17 Identity = 45/98 (45.92%), Postives = 62/98 (63.27%), Query Frame = 0
BLAST of Spg017722 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 85.1 bits (209), Expect = 5.6e-16 Identity = 46/97 (47.42%), Postives = 54/97 (55.67%), Query Frame = 0
BLAST of Spg017722 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.2e-13 Identity = 37/88 (42.05%), Postives = 54/88 (61.36%), Query Frame = 0
BLAST of Spg017722 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.5e-13 Identity = 37/86 (43.02%), Postives = 58/86 (67.44%), Query Frame = 0
BLAST of Spg017722 vs. ExPASy TrEMBL
Match: A0A6J1F7P2 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111442887 PE=4 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 1.1e-33 Identity = 74/114 (64.91%), Postives = 87/114 (76.32%), Query Frame = 0
BLAST of Spg017722 vs. ExPASy TrEMBL
Match: A0A6J1IHI0 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475768 PE=4 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 8.9e-33 Identity = 71/114 (62.28%), Postives = 87/114 (76.32%), Query Frame = 0
BLAST of Spg017722 vs. ExPASy TrEMBL
Match: A0A6J1F6X0 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111442889 PE=4 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 2.0e-32 Identity = 72/114 (63.16%), Postives = 85/114 (74.56%), Query Frame = 0
BLAST of Spg017722 vs. ExPASy TrEMBL
Match: A0A6J1IK33 (cysteine proteinase inhibitor 6-like OS=Cucurbita maxima OX=3661 GN=LOC111475798 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 6.0e-29 Identity = 67/111 (60.36%), Postives = 77/111 (69.37%), Query Frame = 0
BLAST of Spg017722 vs. ExPASy TrEMBL
Match: A0A6J1DHK4 (cysteine proteinase inhibitor 1-like OS=Momordica charantia OX=3673 GN=LOC111021157 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 3.3e-27 Identity = 68/115 (59.13%), Postives = 81/115 (70.43%), Query Frame = 0
BLAST of Spg017722 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 85.1 bits (209), Expect = 4.0e-17 Identity = 46/97 (47.42%), Postives = 54/97 (55.67%), Query Frame = 0
BLAST of Spg017722 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 65.9 bits (159), Expect = 2.5e-11 Identity = 36/89 (40.45%), Postives = 54/89 (60.67%), Query Frame = 0
BLAST of Spg017722 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 61.2 bits (147), Expect = 6.1e-10 Identity = 34/81 (41.98%), Postives = 43/81 (53.09%), Query Frame = 0
BLAST of Spg017722 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 61.2 bits (147), Expect = 6.1e-10 Identity = 34/81 (41.98%), Postives = 43/81 (53.09%), Query Frame = 0
BLAST of Spg017722 vs. TAIR 10
Match: AT5G05110.1 (Cystatin/monellin family protein ) HSP 1 Score: 58.9 bits (141), Expect = 3.1e-09 Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|