Spg004056 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: five_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GATAGCTCTCGTAAACTAATACATAAATTCAAACTTCAAATTTCAAAAGAAATAAAAAGAAAAAAAGAAATCGGGACCCAAAGTCATTCTTTTTGCGTATAGTTTTATACTTATAGCTCTCGTCTCTCTGTTTTGAAACTAAGAAAAAATCAATCCGATCGTTCAAGAAATCTCAGAGAGAAAAAGAGACGGAAAAATGAGTTACTACAGTCAGCCACCGCCTCCCGTCGGCGTTCCTCCGCCGCAAGGTAACATCAGAACCAATGCTCTTCGTCTTTCTTGGATTTGCAAGGTCCAAATCGAACGGATCTTGCTGTTTTTTCAGTCAAAATCGATGTACTCTTTGTTTTCGCCTCGCTTTCGCGCTTCGATTTGACTGATTTTTGGCTGCGATTCTGTGAATGTCGATTGAATTTTAGGTTATCCGCCGGGAGGTTATCCGAAGGACGCTTATCCACCGCCAGGATATCCGCCGCAGGGCGGTTATCCTCCTGCCGGTTATCCTCAGCCGGGATATCCGCCTCCGGCGTATGGTCCGGCGTACGGTCAACCTCCGCCTCAACATCAACAACAACAACAGCAACAAGTTGGATTCCTTGAAGGCTGGTAAGTCTCTGCTTCTATTTCGTTTTTTGTGACCTTACTGGCTGCGATTTAAATGGCGTTTTCGAGTTGAAATTGAGTCAATGAGTCTTCACGGCGGCGAAGTGCTCGGTTACGGTTACAGATTCGCTGATTATCGGTCCTTGTGCGGCGGAGATTCTTAGTTTTCGAATTTTTGTTTGCTTTTTTCTTTTTTCTTTTTCTTTTTTGGGAATAAAGATCAATTTTTAATATTAAACTTCATGTTTCTGATCCTTTCTATTTTGATCCTAAACTTTCCATTGCGTCAAATTTAACTTTAAATTTAGACAAATTTTCTAATTACAATTTTTGTTAGTTCCACAAAATTTAGCAAAAAAGCATATAAAAATTCCAATAAATTTGCTAATTTCAATAAAATTAAGTTTTGTACCAAATTAAGTTT ATGAGTTACTACAGTCAGCCACCGCCTCCCGTCGGCGTTCCTCCGCCGCAAGGTTATCCGCCGGGAGGTTATCCGAAGGACGCTTATCCACCGCCAGGATATCCGCCGCAGGGCGGTTATCCTCCTGCCGGTTATCCTCAGCCGGGATATCCGCCTCCGGCGTATGGTCCGGCGTACGGTCAACCTCCGCCTCAACATCAACAACAACAACAGCAACAAGTTGGATTCCTTGAAGGCTGGTAA ATGAGTTACTACAGTCAGCCACCGCCTCCCGTCGGCGTTCCTCCGCCGCAAGGTTATCCGCCGGGAGGTTATCCGAAGGACGCTTATCCACCGCCAGGATATCCGCCGCAGGGCGGTTATCCTCCTGCCGGTTATCCTCAGCCGGGATATCCGCCTCCGGCGTATGGTCCGGCGTACGGTCAACCTCCGCCTCAACATCAACAACAACAACAGCAACAAGTTGGATTCCTTGAAGGCTGGTAA MSYYSQPPPPVGVPPPQGYPPGGYPKDAYPPPGYPPQGGYPPAGYPQPGYPPPAYGPAYGQPPPQHQQQQQQQVGFLEGW Homology
BLAST of Spg004056 vs. NCBI nr
Match: XP_022148715.1 (cysteine-rich and transmembrane domain-containing protein WIH2-like [Momordica charantia]) HSP 1 Score: 136.0 bits (341), Expect = 1.5e-28 Identity = 71/79 (89.87%), Postives = 72/79 (91.14%), Query Frame = 0
BLAST of Spg004056 vs. NCBI nr
Match: XP_022927665.1 (cysteine-rich and transmembrane domain-containing protein WIH2-like [Cucurbita moschata] >XP_022989028.1 cysteine-rich and transmembrane domain-containing protein WIH2-like [Cucurbita maxima] >KAG6588716.1 hypothetical protein SDJN03_17281, partial [Cucurbita argyrosperma subsp. sororia] >KAG7022504.1 hypothetical protein SDJN02_16236 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 134.4 bits (337), Expect = 4.3e-28 Identity = 69/79 (87.34%), Postives = 74/79 (93.67%), Query Frame = 0
BLAST of Spg004056 vs. NCBI nr
Match: XP_023529875.1 (cysteine-rich and transmembrane domain-containing protein WIH2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 132.9 bits (333), Expect = 1.2e-27 Identity = 68/79 (86.08%), Postives = 74/79 (93.67%), Query Frame = 0
BLAST of Spg004056 vs. NCBI nr
Match: KAG7011598.1 (hypothetical protein SDJN02_26504, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 125.6 bits (314), Expect = 2.0e-25 Identity = 66/81 (81.48%), Postives = 71/81 (87.65%), Query Frame = 0
BLAST of Spg004056 vs. NCBI nr
Match: XP_023553865.1 (cysteine-rich and transmembrane domain-containing protein WIH2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 124.4 bits (311), Expect = 4.4e-25 Identity = 66/80 (82.50%), Postives = 71/80 (88.75%), Query Frame = 0
BLAST of Spg004056 vs. ExPASy Swiss-Prot
Match: Q8S8M0 (Cysteine-rich and transmembrane domain-containing protein WIH2 OS=Arabidopsis thaliana OX=3702 GN=WIH2 PE=1 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.2e-19 Identity = 62/87 (71.26%), Postives = 63/87 (72.41%), Query Frame = 0
BLAST of Spg004056 vs. ExPASy Swiss-Prot
Match: Q8LCL8 (Cysteine-rich and transmembrane domain-containing protein B OS=Arabidopsis thaliana OX=3702 GN=At3g57160 PE=3 SV=2) HSP 1 Score: 66.2 bits (160), Expect = 1.9e-10 Identity = 50/85 (58.82%), Postives = 51/85 (60.00%), Query Frame = 0
BLAST of Spg004056 vs. ExPASy Swiss-Prot
Match: Q9FJW3 (Cysteine-rich and transmembrane domain-containing protein WIH1 OS=Arabidopsis thaliana OX=3702 GN=WIH1 PE=2 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.0e-08 Identity = 46/78 (58.97%), Postives = 48/78 (61.54%), Query Frame = 0
BLAST of Spg004056 vs. ExPASy Swiss-Prot
Match: Q17094 (Rhodopsin (Fragment) OS=Alloteuthis subulata OX=54069 GN=RHO PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 7.4e-07 Identity = 35/51 (68.63%), Postives = 35/51 (68.63%), Query Frame = 0
BLAST of Spg004056 vs. ExPASy Swiss-Prot
Match: P24603 (Rhodopsin OS=Loligo forbesii OX=6618 GN=RHO PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 7.4e-07 Identity = 35/51 (68.63%), Postives = 35/51 (68.63%), Query Frame = 0
BLAST of Spg004056 vs. ExPASy TrEMBL
Match: A0A6J1D3P4 (cysteine-rich and transmembrane domain-containing protein WIH2-like OS=Momordica charantia OX=3673 GN=LOC111017311 PE=3 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 7.1e-29 Identity = 71/79 (89.87%), Postives = 72/79 (91.14%), Query Frame = 0
BLAST of Spg004056 vs. ExPASy TrEMBL
Match: A0A6J1JP18 (cysteine-rich and transmembrane domain-containing protein WIH2-like OS=Cucurbita maxima OX=3661 GN=LOC111486213 PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 2.1e-28 Identity = 69/79 (87.34%), Postives = 74/79 (93.67%), Query Frame = 0
BLAST of Spg004056 vs. ExPASy TrEMBL
Match: A0A6J1EPM1 (cysteine-rich and transmembrane domain-containing protein WIH2-like OS=Cucurbita moschata OX=3662 GN=LOC111434485 PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 2.1e-28 Identity = 69/79 (87.34%), Postives = 74/79 (93.67%), Query Frame = 0
BLAST of Spg004056 vs. ExPASy TrEMBL
Match: A0A6J1GJV9 (cysteine-rich and transmembrane domain-containing protein WIH2-like OS=Cucurbita moschata OX=3662 GN=LOC111454944 PE=4 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 1.8e-24 Identity = 65/80 (81.25%), Postives = 70/80 (87.50%), Query Frame = 0
BLAST of Spg004056 vs. ExPASy TrEMBL
Match: A0A5A7SME1 (Cysteine-rich and transmembrane domain-containing protein A-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold13G001290 PE=4 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 6.9e-24 Identity = 65/82 (79.27%), Postives = 71/82 (86.59%), Query Frame = 0
BLAST of Spg004056 vs. TAIR 10
Match: AT2G41420.1 (proline-rich family protein ) HSP 1 Score: 95.9 bits (237), Expect = 1.6e-20 Identity = 62/87 (71.26%), Postives = 63/87 (72.41%), Query Frame = 0
BLAST of Spg004056 vs. TAIR 10
Match: AT3G49845.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: root; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 60.8 bits (146), Expect = 5.6e-10 Identity = 49/107 (45.79%), Postives = 56/107 (52.34%), Query Frame = 0
BLAST of Spg004056 vs. TAIR 10
Match: AT5G67600.1 (unknown protein; LOCATED IN: plasma membrane; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G49845.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 60.5 bits (145), Expect = 7.3e-10 Identity = 46/78 (58.97%), Postives = 48/78 (61.54%), Query Frame = 0
BLAST of Spg004056 vs. TAIR 10
Match: AT5G45350.1 (proline-rich family protein ) HSP 1 Score: 47.8 bits (112), Expect = 4.9e-06 Identity = 37/66 (56.06%), Postives = 38/66 (57.58%), Query Frame = 0
BLAST of Spg004056 vs. TAIR 10
Match: AT5G45350.2 (proline-rich family protein ) HSP 1 Score: 47.8 bits (112), Expect = 4.9e-06 Identity = 37/66 (56.06%), Postives = 38/66 (57.58%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|