Sed0013923 (gene) Chayote v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGCGAGATATGCAGACTAAAGAGGATTTGAAAACTGTGGCATTGGGCACATCGAAGATCAACTACCTTGATCCTCGAATCACAGTTGCATGGTGCAAGCGTCATGAAGTCCCGATCGAAAAGGTGAGCAGCATTTTGTTGCCATTCTTGGTGCACTATTTGACATTTTGAATCAAACTGTTTCCTAAATTTTCTCTCTTCCATTTCTTCTACTTCCATAGATATTCAATAAGTCTCTTCTAGCTAAGTTTTCTTGGGCAATGGACGTGGATCCCGACTTCAGATTCTGA ATGGAGCGAGATATGCAGACTAAAGAGGATTTGAAAACTGTGGCATTGGGCACATCGAAGATCAACTACCTTGATCCTCGAATCACAGTTGCATGGTGCAAGCGTCATGAAGTCCCGATCGAAAAGATATTCAATAAGTCTCTTCTAGCTAAGTTTTCTTGGGCAATGGACGTGGATCCCGACTTCAGATTCTGA ATGGAGCGAGATATGCAGACTAAAGAGGATTTGAAAACTGTGGCATTGGGCACATCGAAGATCAACTACCTTGATCCTCGAATCACAGTTGCATGGTGCAAGCGTCATGAAGTCCCGATCGAAAAGATATTCAATAAGTCTCTTCTAGCTAAGTTTTCTTGGGCAATGGACGTGGATCCCGACTTCAGATTCTGA MERDMQTKEDLKTVALGTSKINYLDPRITVAWCKRHEVPIEKIFNKSLLAKFSWAMDVDPDFRF Homology
BLAST of Sed0013923 vs. NCBI nr
Match: MBA0716522.1 (hypothetical protein [Gossypium laxum]) HSP 1 Score: 136.0 bits (341), Expect = 1.2e-28 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sed0013923 vs. NCBI nr
Match: KAB2059363.1 (hypothetical protein ES319_A11G297100v1 [Gossypium barbadense] >KAB2059364.1 hypothetical protein ES319_A11G297100v1 [Gossypium barbadense] >KAB2059365.1 hypothetical protein ES319_A11G297100v1 [Gossypium barbadense] >TYG96148.1 hypothetical protein ES288_A11G324700v1 [Gossypium darwinii]) HSP 1 Score: 136.0 bits (341), Expect = 1.2e-28 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sed0013923 vs. NCBI nr
Match: XP_016684952.1 (DNA topoisomerase 1 alpha [Gossypium hirsutum] >XP_016684953.1 DNA topoisomerase 1 alpha [Gossypium hirsutum] >XP_016684954.1 DNA topoisomerase 1 alpha [Gossypium hirsutum] >XP_016684955.1 DNA topoisomerase 1 alpha [Gossypium hirsutum] >XP_016684956.1 DNA topoisomerase 1 alpha [Gossypium hirsutum] >XP_016684957.1 DNA topoisomerase 1 alpha [Gossypium hirsutum] >XP_016684958.1 DNA topoisomerase 1 alpha [Gossypium hirsutum] >XP_016684959.1 DNA topoisomerase 1 alpha [Gossypium hirsutum] >KAG4150142.1 hypothetical protein ERO13_D05G377000v2 [Gossypium hirsutum] >KAG4150143.1 hypothetical protein ERO13_D05G377000v2 [Gossypium hirsutum] >KAG4150144.1 hypothetical protein ERO13_D05G377000v2 [Gossypium hirsutum] >KAG4150145.1 hypothetical protein ERO13_D05G377000v2 [Gossypium hirsutum] >KAG4150146.1 hypothetical protein ERO13_D05G377000v2 [Gossypium hirsutum]) HSP 1 Score: 136.0 bits (341), Expect = 1.2e-28 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sed0013923 vs. NCBI nr
Match: XP_039072279.1 (DNA topoisomerase 1 alpha-like isoform X2 [Hibiscus syriacus]) HSP 1 Score: 136.0 bits (341), Expect = 1.2e-28 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sed0013923 vs. NCBI nr
Match: TYG47376.1 (hypothetical protein ES288_D11G333200v1 [Gossypium darwinii]) HSP 1 Score: 136.0 bits (341), Expect = 1.2e-28 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sed0013923 vs. ExPASy Swiss-Prot
Match: Q9FJ79 (DNA topoisomerase 1 beta OS=Arabidopsis thaliana OX=3702 GN=TOP1B PE=1 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 2.9e-30 Identity = 59/64 (92.19%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sed0013923 vs. ExPASy Swiss-Prot
Match: P30181 (DNA topoisomerase 1 alpha OS=Arabidopsis thaliana OX=3702 GN=TOP1A PE=1 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 2.1e-28 Identity = 57/64 (89.06%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of Sed0013923 vs. ExPASy Swiss-Prot
Match: P93119 (DNA topoisomerase 1 OS=Daucus carota OX=4039 GN=TOP1 PE=2 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 6.7e-27 Identity = 57/64 (89.06%), Postives = 60/64 (93.75%), Query Frame = 0
BLAST of Sed0013923 vs. ExPASy Swiss-Prot
Match: Q54RC3 (DNA topoisomerase 1 OS=Dictyostelium discoideum OX=44689 GN=top1 PE=3 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 6.3e-17 Identity = 40/57 (70.18%), Postives = 49/57 (85.96%), Query Frame = 0
BLAST of Sed0013923 vs. ExPASy Swiss-Prot
Match: P30189 (DNA topoisomerase 1 OS=Drosophila melanogaster OX=7227 GN=Top1 PE=1 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.4e-16 Identity = 38/65 (58.46%), Postives = 52/65 (80.00%), Query Frame = 0
BLAST of Sed0013923 vs. ExPASy TrEMBL
Match: A0A5D2CVC7 (DNA topoisomerase I OS=Gossypium darwinii OX=34276 GN=ES288_D05G448900v1 PE=3 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 5.7e-29 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sed0013923 vs. ExPASy TrEMBL
Match: A0A5D2GSE6 (DNA topoisomerase I OS=Gossypium darwinii OX=34276 GN=ES288_A04G014800v1 PE=3 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 5.7e-29 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sed0013923 vs. ExPASy TrEMBL
Match: A0A1U8M0M5 (DNA topoisomerase I OS=Gossypium hirsutum OX=3635 GN=LOC107932759 PE=3 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 5.7e-29 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sed0013923 vs. ExPASy TrEMBL
Match: A0A1U8J3R4 (DNA topoisomerase I OS=Gossypium hirsutum OX=3635 GN=LOC107903422 PE=3 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 5.7e-29 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sed0013923 vs. ExPASy TrEMBL
Match: A0A5J5RPE8 (DNA topoisomerase I OS=Gossypium barbadense OX=3634 GN=ES319_D05G417500v1 PE=3 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 5.7e-29 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sed0013923 vs. TAIR 10
Match: AT5G55310.1 (DNA topoisomerase 1 beta ) HSP 1 Score: 131.7 bits (330), Expect = 2.1e-31 Identity = 59/64 (92.19%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sed0013923 vs. TAIR 10
Match: AT5G55300.1 (DNA topoisomerase I alpha ) HSP 1 Score: 125.6 bits (314), Expect = 1.5e-29 Identity = 57/64 (89.06%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of Sed0013923 vs. TAIR 10
Match: AT5G55300.3 (DNA topoisomerase I alpha ) HSP 1 Score: 125.6 bits (314), Expect = 1.5e-29 Identity = 57/64 (89.06%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of Sed0013923 vs. TAIR 10
Match: AT4G26701.1 (DNA binding;DNA topoisomerase type Is ) HSP 1 Score: 125.2 bits (313), Expect = 1.9e-29 Identity = 57/64 (89.06%), Postives = 60/64 (93.75%), Query Frame = 0
BLAST of Sed0013923 vs. TAIR 10
Match: AT5G55300.2 (DNA topoisomerase I alpha ) HSP 1 Score: 120.6 bits (301), Expect = 4.8e-28 Identity = 55/61 (90.16%), Postives = 58/61 (95.08%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Chayote (edule) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|