Pay0018118 (gene) Melon (Payzawat) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGCAAGAGACCCTCTGGAACCACGCAAGCATTTTTCGTCTTCTCAGCCTTGGCGATGGGTTGGCTCGCCATTGAGATGGCTTTCAAACCCTTCCTCGATAAGGCCCGCTCCGCCATGGACAAATCTGATCCCGCTCGGGATCCTGACGAACTTGTCGATAACCAATCCGATCACACCTCATCTGATGACGATCAAAGTACCACTGTCACTTCTTAA ATGAGCAAGAGACCCTCTGGAACCACGCAAGCATTTTTCGTCTTCTCAGCCTTGGCGATGGGTTGGCTCGCCATTGAGATGGCTTTCAAACCCTTCCTCGATAAGGCCCGCTCCGCCATGGACAAATCTGATCCCGCTCGGGATCCTGACGAACTTGTCGATAACCAATCCGATCACACCTCATCTGATGACGATCAAAGTACCACTGTCACTTCTTAA ATGAGCAAGAGACCCTCTGGAACCACGCAAGCATTTTTCGTCTTCTCAGCCTTGGCGATGGGTTGGCTCGCCATTGAGATGGCTTTCAAACCCTTCCTCGATAAGGCCCGCTCCGCCATGGACAAATCTGATCCCGCTCGGGATCCTGACGAACTTGTCGATAACCAATCCGATCACACCTCATCTGATGACGATCAAAGTACCACTGTCACTTCTTAA MSKRPSGTTQAFFVFSALAMGWLAIEMAFKPFLDKARSAMDKSDPARDPDELVDNQSDHTSSDDDQSTTVTS Homology
BLAST of Pay0018118 vs. ExPASy Swiss-Prot
Match: Q9SVC4 (Outer envelope membrane protein 7 OS=Arabidopsis thaliana OX=3702 GN=OEP7 PE=1 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-09 Identity = 34/61 (55.74%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of Pay0018118 vs. ExPASy TrEMBL
Match: A0A5A7URM9 (6.7 kDa chloroplast outer envelope membrane protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold496G00570 PE=4 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 1.1e-28 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Pay0018118 vs. ExPASy TrEMBL
Match: A0A6J1DS29 (outer envelope membrane protein 7-like OS=Momordica charantia OX=3673 GN=LOC111022685 PE=4 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 2.9e-21 Identity = 56/69 (81.16%), Postives = 61/69 (88.41%), Query Frame = 0
BLAST of Pay0018118 vs. ExPASy TrEMBL
Match: A0A6J1HGS4 (outer envelope membrane protein 7-like OS=Cucurbita moschata OX=3662 GN=LOC111463949 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 1.2e-19 Identity = 52/69 (75.36%), Postives = 59/69 (85.51%), Query Frame = 0
BLAST of Pay0018118 vs. ExPASy TrEMBL
Match: A0A6J1HUQ5 (outer envelope membrane protein 7-like OS=Cucurbita maxima OX=3661 GN=LOC111467002 PE=4 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 2.1e-19 Identity = 51/68 (75.00%), Postives = 59/68 (86.76%), Query Frame = 0
BLAST of Pay0018118 vs. ExPASy TrEMBL
Match: A0A0A0KJE9 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G409970 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 5.6e-17 Identity = 53/72 (73.61%), Postives = 59/72 (81.94%), Query Frame = 0
BLAST of Pay0018118 vs. NCBI nr
Match: KAA0057297.1 (6.7 kDa chloroplast outer envelope membrane protein [Cucumis melo var. makuwa] >TYK13436.1 6.7 kDa chloroplast outer envelope membrane protein [Cucumis melo var. makuwa]) HSP 1 Score: 135.2 bits (339), Expect = 2.3e-28 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Pay0018118 vs. NCBI nr
Match: XP_038888886.1 (outer envelope membrane protein 7-like [Benincasa hispida] >XP_038888887.1 outer envelope membrane protein 7-like [Benincasa hispida] >XP_038888888.1 outer envelope membrane protein 7-like [Benincasa hispida] >XP_038888889.1 outer envelope membrane protein 7-like [Benincasa hispida]) HSP 1 Score: 115.9 bits (289), Expect = 1.4e-22 Identity = 59/72 (81.94%), Postives = 65/72 (90.28%), Query Frame = 0
BLAST of Pay0018118 vs. NCBI nr
Match: XP_022155586.1 (outer envelope membrane protein 7-like [Momordica charantia]) HSP 1 Score: 110.5 bits (275), Expect = 5.9e-21 Identity = 56/69 (81.16%), Postives = 61/69 (88.41%), Query Frame = 0
BLAST of Pay0018118 vs. NCBI nr
Match: XP_023553591.1 (outer envelope membrane protein 7-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 107.5 bits (267), Expect = 5.0e-20 Identity = 53/69 (76.81%), Postives = 60/69 (86.96%), Query Frame = 0
BLAST of Pay0018118 vs. NCBI nr
Match: XP_022963695.1 (outer envelope membrane protein 7-like [Cucurbita moschata] >XP_022963696.1 outer envelope membrane protein 7-like [Cucurbita moschata] >XP_022963697.1 outer envelope membrane protein 7-like [Cucurbita moschata] >KAG7011240.1 Outer envelope membrane protein 7, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 105.1 bits (261), Expect = 2.5e-19 Identity = 52/69 (75.36%), Postives = 59/69 (85.51%), Query Frame = 0
BLAST of Pay0018118 vs. TAIR 10
Match: AT3G52420.1 (outer envelope membrane protein 7 ) HSP 1 Score: 63.5 bits (153), Expect = 7.8e-11 Identity = 34/61 (55.74%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of Pay0018118 vs. TAIR 10
Match: AT3G63160.1 (FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast outer membrane, thylakoid, chloroplast thylakoid membrane, chloroplast, chloroplast envelope; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: outer envelope membrane protein 7 (TAIR:AT3G52420.1); Has 26 Blast hits to 26 proteins in 8 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 26; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 42.4 bits (98), Expect = 1.9e-04 Identity = 22/43 (51.16%), Postives = 28/43 (65.12%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Payzawat) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|