
PI0027490 (gene) Melon (PI 482460) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGATTTTTTATGCTATGAAAAGCTTGTGCCTTCTGGTGATTGTGATGGAGGTGGTTGTCAATGAAACTCACTTGGTGGAGGCAGTGAAATGTGATACAAAGGAGCTAAGAGTATGTCTTTGGGCCTTCACAATGTCAGTGAAACCATCAACAGCTTGCTGCAAGAAGTTGAAAGAACACAGACCATGCTATTGTGGATACAAGAAAAATCCAAAGATTAAATCCTATTTACAATATGATGCTGCAAAAAAGCTCATTTCTCGTTGTGGCGTTGTCATCCCAACTAATTGCTAA ATGAAGATTTTTTATGCTATGAAAAGCTTGTGCCTTCTGGTGATTGTGATGGAGGTGGTTGTCAATGAAACTCACTTGGTGGAGGCAGTGAAATGTGATACAAAGGAGCTAAGAGTATGTCTTTGGGCCTTCACAATGTCAGTGAAACCATCAACAGCTTGCTGCAAGAAGTTGAAAGAACACAGACCATGCTATTGTGGATACAAGAAAAATCCAAAGATTAAATCCTATTTACAATATGATGCTGCAAAAAAGCTCATTTCTCGTTGTGGCGTTGTCATCCCAACTAATTGCTAA ATGAAGATTTTTTATGCTATGAAAAGCTTGTGCCTTCTGGTGATTGTGATGGAGGTGGTTGTCAATGAAACTCACTTGGTGGAGGCAGTGAAATGTGATACAAAGGAGCTAAGAGTATGTCTTTGGGCCTTCACAATGTCAGTGAAACCATCAACAGCTTGCTGCAAGAAGTTGAAAGAACACAGACCATGCTATTGTGGATACAAGAAAAATCCAAAGATTAAATCCTATTTACAATATGATGCTGCAAAAAAGCTCATTTCTCGTTGTGGCGTTGTCATCCCAACTAATTGCTAA MKIFYAMKSLCLLVIVMEVVVNETHLVEAVKCDTKELRVCLWAFTMSVKPSTACCKKLKEHRPCYCGYKKNPKIKSYLQYDAAKKLISRCGVVIPTNC Homology
BLAST of PI0027490 vs. ExPASy Swiss-Prot
Match: Q43681 (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata OX=3917 PE=2 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 3.1e-15 Identity = 42/98 (42.86%), Postives = 57/98 (58.16%), Query Frame = 0
BLAST of PI0027490 vs. ExPASy Swiss-Prot
Match: P86809 (Non-specific lipid-transfer protein 2 OS=Apium graveolens var. rapaceum OX=278110 PE=1 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 4.2e-12 Identity = 30/63 (47.62%), Postives = 39/63 (61.90%), Query Frame = 0
BLAST of PI0027490 vs. ExPASy Swiss-Prot
Match: P82353 (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca OX=36596 PE=1 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 4.6e-11 Identity = 29/66 (43.94%), Postives = 37/66 (56.06%), Query Frame = 0
BLAST of PI0027490 vs. ExPASy Swiss-Prot
Match: A2XBN5 (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. indica OX=39946 GN=LTP-2 PE=3 SV=2) HSP 1 Score: 58.2 bits (139), Expect = 6.2e-08 Identity = 28/93 (30.11%), Postives = 48/93 (51.61%), Query Frame = 0
BLAST of PI0027490 vs. ExPASy Swiss-Prot
Match: Q10ST8 (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=LTP-2 PE=1 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 8.2e-08 Identity = 28/93 (30.11%), Postives = 48/93 (51.61%), Query Frame = 0
BLAST of PI0027490 vs. ExPASy TrEMBL
Match: A0A0A0M3W7 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G711160 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 1.1e-20 Identity = 52/90 (57.78%), Postives = 68/90 (75.56%), Query Frame = 0
BLAST of PI0027490 vs. ExPASy TrEMBL
Match: A0A438G8N7 (Putative non-specific lipid-transfer protein AKCS9 OS=Vitis vinifera OX=29760 GN=NLTP_5 PE=4 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 3.2e-15 Identity = 47/98 (47.96%), Postives = 61/98 (62.24%), Query Frame = 0
BLAST of PI0027490 vs. ExPASy TrEMBL
Match: A0A438G8G4 (Non-specific lipid-transfer protein 2 OS=Vitis vinifera OX=29760 GN=NLTP2_8 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 7.1e-15 Identity = 45/96 (46.88%), Postives = 60/96 (62.50%), Query Frame = 0
BLAST of PI0027490 vs. ExPASy TrEMBL
Match: A0A6A4PCA3 (Putative bifunctional inhibitor/plant lipid transfer protein/seed storage helical OS=Lupinus albus OX=3870 GN=Lalb_Chr14g0364861 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 7.1e-15 Identity = 41/97 (42.27%), Postives = 64/97 (65.98%), Query Frame = 0
BLAST of PI0027490 vs. ExPASy TrEMBL
Match: A0A4Y1R5X1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein OS=Prunus dulcis OX=3755 GN=Prudu_009299 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 9.3e-15 Identity = 42/95 (44.21%), Postives = 58/95 (61.05%), Query Frame = 0
BLAST of PI0027490 vs. NCBI nr
Match: KGN66906.1 (hypothetical protein Csa_006987 [Cucumis sativus]) HSP 1 Score: 109.0 bits (271), Expect = 2.4e-20 Identity = 52/90 (57.78%), Postives = 68/90 (75.56%), Query Frame = 0
BLAST of PI0027490 vs. NCBI nr
Match: KAE8648143.1 (hypothetical protein Csa_023893, partial [Cucumis sativus]) HSP 1 Score: 98.2 bits (243), Expect = 4.2e-17 Identity = 39/82 (47.56%), Postives = 57/82 (69.51%), Query Frame = 0
BLAST of PI0027490 vs. NCBI nr
Match: KAE8648147.1 (hypothetical protein Csa_023900, partial [Cucumis sativus]) HSP 1 Score: 94.7 bits (234), Expect = 4.6e-16 Identity = 37/71 (52.11%), Postives = 51/71 (71.83%), Query Frame = 0
BLAST of PI0027490 vs. NCBI nr
Match: XP_038904866.1 (non-specific lipid-transfer protein 2-like [Benincasa hispida]) HSP 1 Score: 94.0 bits (232), Expect = 7.8e-16 Identity = 45/87 (51.72%), Postives = 57/87 (65.52%), Query Frame = 0
BLAST of PI0027490 vs. NCBI nr
Match: RVW68518.1 (putative non-specific lipid-transfer protein AKCS9 [Vitis vinifera]) HSP 1 Score: 90.9 bits (224), Expect = 6.6e-15 Identity = 47/98 (47.96%), Postives = 61/98 (62.24%), Query Frame = 0
BLAST of PI0027490 vs. TAIR 10
Match: AT5G38170.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 67.0 bits (162), Expect = 9.5e-12 Identity = 30/67 (44.78%), Postives = 38/67 (56.72%), Query Frame = 0
BLAST of PI0027490 vs. TAIR 10
Match: AT1G66850.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 66.6 bits (161), Expect = 1.2e-11 Identity = 29/67 (43.28%), Postives = 39/67 (58.21%), Query Frame = 0
BLAST of PI0027490 vs. TAIR 10
Match: AT3G18280.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 65.5 bits (158), Expect = 2.8e-11 Identity = 35/89 (39.33%), Postives = 48/89 (53.93%), Query Frame = 0
BLAST of PI0027490 vs. TAIR 10
Match: AT1G48750.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 65.1 bits (157), Expect = 3.6e-11 Identity = 29/85 (34.12%), Postives = 47/85 (55.29%), Query Frame = 0
BLAST of PI0027490 vs. TAIR 10
Match: AT5G38160.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 64.7 bits (156), Expect = 4.7e-11 Identity = 29/67 (43.28%), Postives = 37/67 (55.22%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (PI 482460) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|