PI0022818 (gene) Melon (PI 482460) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.CCCACACCAAACTTTGTAAGCTCACAAATAGAAAGATAACAATTCCGAGATCATGTCGTCCCCATCCGTTCGTAAGTATATCTTTTGGTGTAATTTTTTGTGTTGAGTTCATCTCTTTTCTTCCAAGTTATATATATATACACTTTTTAATCTTTGCTAATTAACAATAATATATATACTTTTTGCCAATATGTTTCGAAACAGTAAAATCATGGCCAGAACTAAACTTCATAGATGCAAACACTGTGGCAAATATCATCAAGAGAGAGAATCCTAACTTTCAACCAGTCATATTGTTGGCAGGAAGTCCAGTAACAAAGGATCTTAAGCCTGGTCGAGTTCGACTCTTTACTAATGTGCAGGGAATAGTGGTTATTGTTCCTCAAGAGGGCTGAAATGTAAACATACATGTTTCAAATAATAAATAAAAGTAATAATCTATTTCTACT CCCACACCAAACTTTGTAAGCTCACAAATAGAAAGATAACAATTCCGAGATCATGTCGTCCCCATCCGTTCTAAAATCATGGCCAGAACTAAACTTCATAGATGCAAACACTGTGGCAAATATCATCAAGAGAGAGAATCCTAACTTTCAACCAGTCATATTGTTGGCAGGAAGTCCAGTAACAAAGGATCTTAAGCCTGGTCGAGTTCGACTCTTTACTAATGTGCAGGGAATAGTGGTTATTGTTCCTCAAGAGGGCTGAAATGTAAACATACATGTTTCAAATAATAAATAAAAGTAATAATCTATTTCTACT ATGTCGTCCCCATCCGTTCTAAAATCATGGCCAGAACTAAACTTCATAGATGCAAACACTGTGGCAAATATCATCAAGAGAGAGAATCCTAACTTTCAACCAGTCATATTGTTGGCAGGAAGTCCAGTAACAAAGGATCTTAAGCCTGGTCGAGTTCGACTCTTTACTAATGTGCAGGGAATAGTGGTTATTGTTCCTCAAGAGGGCTGA MSSPSVLKSWPELNFIDANTVANIIKRENPNFQPVILLAGSPVTKDLKPGRVRLFTNVQGIVVIVPQEG Homology
BLAST of PI0022818 vs. ExPASy Swiss-Prot
Match: P19873 (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.5e-08 Identity = 28/61 (45.90%), Postives = 40/61 (65.57%), Query Frame = 0
BLAST of PI0022818 vs. ExPASy Swiss-Prot
Match: P16231 (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum OX=4082 PE=3 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 7.5e-08 Identity = 30/59 (50.85%), Postives = 39/59 (66.10%), Query Frame = 0
BLAST of PI0022818 vs. ExPASy Swiss-Prot
Match: Q03199 (Proteinase inhibitor I-B OS=Nicotiana tabacum OX=4097 GN=TIMPA PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 3.7e-07 Identity = 33/68 (48.53%), Postives = 39/68 (57.35%), Query Frame = 0
BLAST of PI0022818 vs. ExPASy Swiss-Prot
Match: Q03198 (Proteinase inhibitor I-A OS=Nicotiana tabacum OX=4097 GN=TIMPB PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 6.3e-07 Identity = 32/68 (47.06%), Postives = 38/68 (55.88%), Query Frame = 0
BLAST of PI0022818 vs. ExPASy Swiss-Prot
Match: P05118 (Wound-induced proteinase inhibitor 1 OS=Solanum lycopersicum OX=4081 GN=PIIF PE=2 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 1.8e-06 Identity = 27/58 (46.55%), Postives = 36/58 (62.07%), Query Frame = 0
BLAST of PI0022818 vs. ExPASy TrEMBL
Match: A0A0A0LIF6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G914570 PE=3 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 3.0e-20 Identity = 56/71 (78.87%), Postives = 61/71 (85.92%), Query Frame = 0
BLAST of PI0022818 vs. ExPASy TrEMBL
Match: A0A0A0LFD4 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G914580 PE=3 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 1.1e-14 Identity = 44/69 (63.77%), Postives = 50/69 (72.46%), Query Frame = 0
BLAST of PI0022818 vs. ExPASy TrEMBL
Match: A0A0A0KPI0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G027950 PE=3 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 4.9e-10 Identity = 32/61 (52.46%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of PI0022818 vs. ExPASy TrEMBL
Match: A0A6J1CY53 (inhibitor of trypsin and hageman factor-like OS=Momordica charantia OX=3673 GN=LOC111015335 PE=3 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 1.1e-09 Identity = 37/79 (46.84%), Postives = 50/79 (63.29%), Query Frame = 0
BLAST of PI0022818 vs. ExPASy TrEMBL
Match: A0A397ZK38 (Uncharacterized protein OS=Brassica campestris OX=3711 GN=BRARA_D01163 PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 6.6e-07 Identity = 31/63 (49.21%), Postives = 41/63 (65.08%), Query Frame = 0
BLAST of PI0022818 vs. NCBI nr
Match: KGN60477.1 (hypothetical protein Csa_001998 [Cucumis sativus]) HSP 1 Score: 107.1 bits (266), Expect = 6.3e-20 Identity = 56/71 (78.87%), Postives = 61/71 (85.92%), Query Frame = 0
BLAST of PI0022818 vs. NCBI nr
Match: KAG6571807.1 (hypothetical protein SDJN03_28535, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 99.8 bits (247), Expect = 1.0e-17 Identity = 48/64 (75.00%), Postives = 55/64 (85.94%), Query Frame = 0
BLAST of PI0022818 vs. NCBI nr
Match: KGN60478.1 (hypothetical protein Csa_001396 [Cucumis sativus]) HSP 1 Score: 88.6 bits (218), Expect = 2.3e-14 Identity = 44/69 (63.77%), Postives = 50/69 (72.46%), Query Frame = 0
BLAST of PI0022818 vs. NCBI nr
Match: XP_011654473.1 (inhibitor of trypsin and hageman factor [Cucumis sativus] >KGN49621.1 hypothetical protein Csa_018430 [Cucumis sativus]) HSP 1 Score: 73.2 bits (178), Expect = 1.0e-09 Identity = 32/61 (52.46%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of PI0022818 vs. NCBI nr
Match: XP_022146026.1 (inhibitor of trypsin and hageman factor-like [Momordica charantia]) HSP 1 Score: 72.0 bits (175), Expect = 2.2e-09 Identity = 37/79 (46.84%), Postives = 50/79 (63.29%), Query Frame = 0
BLAST of PI0022818 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 57.0 bits (136), Expect = 7.0e-09 Identity = 27/61 (44.26%), Postives = 37/61 (60.66%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (PI 482460) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|