![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
PI0020401 (gene) Melon (PI 482460) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGCAAACATGGAGCTCCATCATTGGATGCTCGCCAAGAAATGATGCAAGAAGAAGTTCCCAAATTAGGAAAAGAAGCAGCTTTGAAAGCCATTCAAGAATGGGGTCAACCAATCTCAAATATTACACATCTCATATTTTGCACTACTTCAACCAAACTTCATTCCTGGGCCTGATTGCCATCTCTCTAAGCTTCTTGGACTTAACAACTCCACAAAAAAATTCATGTTATATAACCAAGGTTGTTTTGTAGCTGGAACTGCACTTCGTTTAGCTAAGGATCTTGCAAGATCGATTGGACATTTTGGTTGGTCAAGCCTTATTTTCTGA ATGTGCAAACATGGAGCTCCATCATTGGATGCTCGCCAAGAAATGATGCAAGAAGAAGTTCCCAAATTAGGAAAAGAAGCAGCTTTGAAAGCCATTCAAGAATGGGGTTGTTTTGTAGCTGGAACTGCACTTCGTTTAGCTAAGGATCTTGCAAGATCGATTGGACATTTTGGTTGGTCAAGCCTTATTTTCTGA ATGTGCAAACATGGAGCTCCATCATTGGATGCTCGCCAAGAAATGATGCAAGAAGAAGTTCCCAAATTAGGAAAAGAAGCAGCTTTGAAAGCCATTCAAGAATGGGGTTGTTTTGTAGCTGGAACTGCACTTCGTTTAGCTAAGGATCTTGCAAGATCGATTGGACATTTTGGTTGGTCAAGCCTTATTTTCTGA MCKHGAPSLDARQEMMQEEVPKLGKEAALKAIQEWGCFVAGTALRLAKDLARSIGHFGWSSLIF Homology
BLAST of PI0020401 vs. ExPASy Swiss-Prot
Match: P30081 (Chalcone synthase 7 OS=Glycine max OX=3847 GN=CHS7 PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 3.7e-09 Identity = 39/98 (39.80%), Postives = 45/98 (45.92%), Query Frame = 0
BLAST of PI0020401 vs. ExPASy Swiss-Prot
Match: Q9ZRR8 (Chalcone synthase OS=Casuarina glauca OX=3522 GN=CHS1 PE=2 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 4.8e-09 Identity = 38/98 (38.78%), Postives = 45/98 (45.92%), Query Frame = 0
BLAST of PI0020401 vs. ExPASy Swiss-Prot
Match: Q9AU11 (Polyketide synthase 1 OS=Rubus idaeus OX=32247 GN=PKS1 PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 4.8e-09 Identity = 38/98 (38.78%), Postives = 45/98 (45.92%), Query Frame = 0
BLAST of PI0020401 vs. ExPASy Swiss-Prot
Match: Q9AU10 (Inactive polyketide synthase 2 OS=Rubus idaeus OX=32247 GN=PKS2 PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 4.8e-09 Identity = 38/98 (38.78%), Postives = 45/98 (45.92%), Query Frame = 0
BLAST of PI0020401 vs. ExPASy Swiss-Prot
Match: Q9AU09 (Polyketide synthase 3 OS=Rubus idaeus OX=32247 GN=PKS3 PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 4.8e-09 Identity = 38/98 (38.78%), Postives = 45/98 (45.92%), Query Frame = 0
BLAST of PI0020401 vs. ExPASy TrEMBL
Match: A0A5D3D594 (Chalcone synthase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold481G00380 PE=4 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 5.7e-13 Identity = 50/96 (52.08%), Postives = 51/96 (53.12%), Query Frame = 0
BLAST of PI0020401 vs. ExPASy TrEMBL
Match: A0A6A3B2H2 (Chalcone synthase OS=Hibiscus syriacus OX=106335 GN=F3Y22_tig00110328pilonHSYRG01233 PE=3 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 2.2e-09 Identity = 34/48 (70.83%), Postives = 39/48 (81.25%), Query Frame = 0
BLAST of PI0020401 vs. ExPASy TrEMBL
Match: A0A1R3J345 (Uncharacterized protein OS=Corchorus capsularis OX=210143 GN=CCACVL1_07979 PE=3 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 3.8e-09 Identity = 38/69 (55.07%), Postives = 44/69 (63.77%), Query Frame = 0
BLAST of PI0020401 vs. ExPASy TrEMBL
Match: M0T5Z0 (Uncharacterized protein OS=Musa acuminata subsp. malaccensis OX=214687 PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 1.1e-08 Identity = 36/71 (50.70%), Postives = 45/71 (63.38%), Query Frame = 0
BLAST of PI0020401 vs. ExPASy TrEMBL
Match: M0RHJ6 (Uncharacterized protein OS=Musa acuminata subsp. malaccensis OX=214687 PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 1.5e-08 Identity = 36/71 (50.70%), Postives = 45/71 (63.38%), Query Frame = 0
BLAST of PI0020401 vs. NCBI nr
Match: TYK18690.1 (chalcone synthase [Cucumis melo var. makuwa]) HSP 1 Score: 82.8 bits (203), Expect = 1.2e-12 Identity = 50/96 (52.08%), Postives = 51/96 (53.12%), Query Frame = 0
BLAST of PI0020401 vs. NCBI nr
Match: QHO06554.1 (Stilbene synthase [Arachis hypogaea]) HSP 1 Score: 71.6 bits (174), Expect = 2.7e-09 Identity = 37/67 (55.22%), Postives = 44/67 (65.67%), Query Frame = 0
BLAST of PI0020401 vs. NCBI nr
Match: KAG5534638.1 (hypothetical protein RHGRI_022680 [Rhododendron griersonianum]) HSP 1 Score: 70.9 bits (172), Expect = 4.6e-09 Identity = 38/70 (54.29%), Postives = 45/70 (64.29%), Query Frame = 0
BLAST of PI0020401 vs. NCBI nr
Match: KAE8710078.1 (Chalcone synthase [Hibiscus syriacus]) HSP 1 Score: 70.9 bits (172), Expect = 4.6e-09 Identity = 34/48 (70.83%), Postives = 39/48 (81.25%), Query Frame = 0
BLAST of PI0020401 vs. NCBI nr
Match: OMO89220.1 (hypothetical protein CCACVL1_07979 [Corchorus capsularis]) HSP 1 Score: 70.1 bits (170), Expect = 7.9e-09 Identity = 38/69 (55.07%), Postives = 44/69 (63.77%), Query Frame = 0
BLAST of PI0020401 vs. TAIR 10
Match: AT5G13930.1 (Chalcone and stilbene synthase family protein ) HSP 1 Score: 57.8 bits (138), Expect = 3.8e-09 Identity = 36/98 (36.73%), Postives = 44/98 (44.90%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (PI 482460) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|